(data stored in ACNUC7421 zone)

EMBL: CP000769.PE582

CP000769.PE582       Location/Qualifiers
FT   CDS_pept        complement(668402..669505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0588"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   mxa:MXAN_2683 methyl accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24802"
FT                   /db_xref="GOA:A7H7V6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V6"
FT                   /protein_id="ABS24802.1"
FT                   /translation="MFARRYAWYGAAFGACFPVIATVLEAASRHGGVGPAALAAALRSP
FT                   LLWIVALAPLVLALLARVAGVRQDRAVAIDAARREAYVRAAGELAGAARSLAEEATRIR
FT                   GGAAEQAAGAAQQASAIAQTSTSAAEIAQMAVRSAERAEGVIAVTDRSGDLSTEGQRAV
FT                   ERVVSGIEDLAAAVESIAQATAELAADARRIGDIVETVKDVAEQSNVLAVNAALEAARA
FT                   GEHGRGFGTVAVEVRSLAEQSRGAAVEVARIVGGVLARVERTASAASEGRSRADGVIAL
FT                   ARSTATAIDSLGGLVRDSATEAREIALAARQQTLGIDEIVAAMGQISAATSAAVSSAAG
FT                   IEQAAKALAEMSHSLGATVERYRAAAE"
     atgttcgccc gcaggtacgc ttggtacggc gccgcattcg gcgcctgctt ccccgtcatc        60
     gccaccgtcc tggaggcggc ctcgcggcac ggcggcgtcg gccccgcggc gctcgccgcg       120
     gcgctgcggt cgccgctcct ctggatcgtc gccctggcgc cgctcgtcct cgcgctgctc       180
     gcgcgcgtgg cgggcgttcg acaggaccgg gccgtcgcga tcgacgccgc gcggcgcgag       240
     gcgtacgtcc gggccgccgg cgagctcgcc ggggcggcgc gatccctggc cgaggaggcg       300
     acgcggatcc gcggcggcgc cgccgagcag gccgccgggg cggcgcagca agcgagcgcg       360
     atcgcgcaga cctccacgtc cgcggcggag atcgcccaga tggcggtgcg ctcggcggag       420
     cgcgccgagg gcgtgatcgc cgtgacggac cgctccggcg atctctccac ggaggggcag       480
     cgcgccgtgg agcgggtcgt gagcgggatc gaggacctcg ccgccgcggt cgaatcgatc       540
     gcgcaggcca ccgcggagct cgcggccgat gcgcggcgca tcggcgacat cgtcgagacc       600
     gtgaaggacg tcgccgagca gtcgaacgtc ctcgccgtga acgccgcgct cgaggcggcg       660
     cgggccggcg agcacggccg cgggttcggg accgtggccg tcgaggtgcg ttccctcgcg       720
     gagcagtccc gcggcgccgc cgtcgaggtg gcgcggatcg tcggcggggt gctcgcccgg       780
     gtggagcgga ccgcgagcgc ggcgagcgag gggcgctcgc gcgccgacgg ggtcatcgcg       840
     ctcgcccgga gcaccgcgac ggcgatcgac agcctggggg gcctcgtgcg cgactcggcc       900
     acggaggcgc gggagatcgc gctggccgcg cggcagcaga cgctcggcat cgacgagatc       960
     gtcgccgcca tgggccagat ctccgccgcg acctcggcgg cggtgagcag cgcggcgggg      1020
     atcgagcagg cggcgaaggc gctcgcggag atgtcacact cgctcggcgc gacggtcgag      1080
     cgctaccggg ccgccgccga gtag                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page