(data stored in ACNUC7421 zone)

EMBL: CP000769.PE584

CP000769.PE584       Location/Qualifiers
FT   CDS_pept        670296..671210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0590"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein;
FT                   KEGG: ttj:TTHB098 NADH-ubiquinone oxidoreductase 39 kDa
FT                   subunit related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24804"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V8"
FT                   /protein_id="ABS24804.1"
FT                   /translation="MSRPHVHAITGAFGYSGQEIARLLLARGERVRTLTGHPERPDPFG
FT                   GRVEVTRFRFDDPSRLRDALAGVRVLYNTYWVRFDHGASTFARAVENSRALFRAAAEAG
FT                   VERVVHVSITNPAPDSPLPYFRGKAEVERALGESGLSHAILRPAVFFGGRDVLINNIAW
FT                   LLRRLPLFGVASGTYGIQPVHVEDLARLAVEHAERGADVVLDAVGPEAFAFDELVGLVR
FT                   RAVRSRAAIVRVPRWLLLGAARALGAPLGDVVLTRDEVLGLTGNLLVSHGRPTAGTRFS
FT                   DWLAAHADELGVAWASELGRHYK"
     atgagccgcc cgcacgtcca cgcgatcacc ggagccttcg gctacagcgg acaggagatc        60
     gcgcggctgc tcctcgcgcg cggcgagcgc gtgaggacgc tcaccggtca cccggagcga       120
     ccggacccgt tcggcggaag ggtcgaggtg acgcgcttcc gcttcgacga tccgtcccgg       180
     ctgcgcgacg cgctcgcggg cgtgcgggtg ctctacaaca cgtactgggt ccgcttcgat       240
     cacggggcct cgacgttcgc gcgggcggtc gagaacagcc gcgccctctt ccgggccgcg       300
     gccgaggcgg gcgtggagcg cgtcgtccac gtgtccatca ccaaccccgc gccggactcg       360
     ccgctgccct acttccgcgg gaaggccgag gtcgagcgcg cgctcggcga atcggggctc       420
     tcccacgcga tcctccgccc cgcggtgttc ttcggcggcc gggacgtcct catcaacaac       480
     atcgcctggc tgctgcggcg gctgccgctg ttcggcgtgg cgtccggtac ctacggcatc       540
     cagccggtgc acgtggagga cctggcccgc ctcgccgtgg agcacgcgga gcgcggcgcc       600
     gacgtggtcc tcgacgcggt cgggcccgag gcgttcgcct tcgacgagct cgtggggctc       660
     gtccggaggg ccgtccgctc gcgggccgcc atcgtacggg tcccgcgctg gctgctcctc       720
     ggcgccgcgc gcgcgctcgg cgctccgctc ggcgacgtgg tgctcacccg agacgaggtc       780
     ctggggctga ccgggaacct cctcgtctcg cacggaaggc ccaccgccgg gacgcgcttc       840
     tcggactggc tcgccgccca cgcggacgag ctcggggtcg cctgggcctc ggagctgggt       900
     agacactaca agtga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page