(data stored in ACNUC7421 zone)

EMBL: CP000769.PE60

CP000769.PE60        Location/Qualifiers
FT   CDS_pept        75899..78457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0060"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: ade:Adeh_0057
FT                   penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24280"
FT                   /db_xref="GOA:A7H6D4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D4"
FT                   /protein_id="ABS24280.1"
FT                   /translation="MTDSRDPTVESGGAPDAPPRVVLDGLPPRRPFVRGLVRWALFLAI
FT                   VAVNAGVVAGIAGYLYFSRGLPELPKLSDYRPPIVTEMVSADGQIAGEFFVERRKVVPY
FT                   ERIPKRLLQAFVASEDQDFFEHGGVDWTGTLRAALNTYVLRRRIQGGSTITQQTAKALL
FT                   ISAEGFESGTRRNLARKLREFILAKRLERAFTKEEILWMYLNGVYLGHHSYGVQAAAEN
FT                   YYRKNVEDLTLEEAALIAGLPQAPSRYSPFSHPEAAKDRRRYVLRRMAEEGFITQEERA
FT                   RGSEAEVKVFGVDDVFRETAPFYVEHARRYVVDRFGNERLLQDGLRVELAMDLEKQRAA
FT                   QAAMLSGLMEVDHRQGYNGPVANVAGAERKTLAERLARAWPKGRLERGEYCVGIVARVD
FT                   DRAGFAEVEVGENRGLLPLSGMRWARRPNPEVFYPDALISRASIAVKTGDVVLLRRVAR
FT                   EDLQKRERELGLGKAASVPEAELLFTLEQEPKLQGALVSVDPWTGYVVAMVGGYDFDAS
FT                   EFNRAFQACRQPGSAFKPLVYAAAIEKLDFTPATILTDAPIVFRDDENSWKPQNYGQDF
FT                   KGDVTLRTALVDSMNIPAVKTAEALSAKVGMQALAEWAKALGLTTPVKLELGTALGSSC
FT                   VNLWELTNVYALFARYGEKRPATFVKRVLDRDGNVLEDRTDWRDPWVGLDARLAAGFAE
FT                   VTRPRARVMDERTAYILVRLLREVATVGTGARASALGKPAAGKTGTTNDSFDTWFMGFT
FT                   HDLATGVWLGYDVNVTPLGRYETGGHAALPIWLSYMRTALDRRPQPEFTAPAGIVEVRI
FT                   DPDTGKPAADGVFEPFKQGTEPSAPAEGQQQVEVQDLFMQ"
     atgaccgaca gccgcgatcc gacggtcgaa tccgggggcg cgccggacgc ccctccccgg        60
     gtggtgctcg acgggcttcc gccccggcgc cccttcgtcc gcgggctcgt ccgctgggcg       120
     ctgttcctgg ccatcgtggc cgtgaacgcg ggcgtggtgg ccgggatcgc cggctacctc       180
     tacttctcgc gcgggctgcc ggagctcccg aagctctccg actaccggcc gcccatcgtc       240
     accgagatgg tgagcgccga cggccagatc gccggggagt tcttcgtcga gcgccgcaag       300
     gtggtcccct acgagcgcat cccgaagcgg ctcctgcagg cgttcgtcgc ctccgaggat       360
     caggacttct tcgagcacgg cggcgtcgac tggacgggca cgctgcgggc ggcgctcaac       420
     acctacgtgc tgcggcgccg gatccagggc ggctcgacca tcacgcagca gaccgccaag       480
     gcgctgctca tcagcgcgga ggggttcgag tcggggacgc ggcggaacct cgcccgcaag       540
     ctgcgcgagt tcatcctcgc gaagcggctc gagcgcgcgt tcacgaagga ggagatcctc       600
     tggatgtacc tgaacggcgt ctacctcggg caccacagct acggggtcca ggcggccgcc       660
     gagaactact accgcaagaa cgtggaggac ctgacgctcg aggaggccgc gctcatcgcc       720
     ggcctccccc aggcgccgtc gcgctactcg ccgttctcgc accccgaggc ggcgaaggac       780
     cgccgccgct acgtgctgcg ccgcatggcg gaggagggct tcatcacgca ggaggagcgg       840
     gcgcgcggct ccgaggcgga ggtgaaggtc ttcggcgtgg acgacgtctt ccgcgagacc       900
     gcgcccttct acgtcgagca cgcgcgccgc tacgtggtgg accgcttcgg caacgagcgg       960
     ctgcttcagg acggcctgcg cgtggagctc gccatggacc tcgagaagca gcgcgcggcg      1020
     caggccgcga tgctctcggg cctcatggag gtggatcacc gccagggcta caacgggccc      1080
     gtcgcgaacg tcgccggggc cgagcggaag acgctcgccg agcggctggc gcgcgcctgg      1140
     ccgaagggga ggctcgagcg cggcgagtac tgcgtgggga tcgtggcccg cgtggacgac      1200
     cgcgccgggt tcgcggaggt ggaggtcggc gagaaccgcg gcctgctccc cctctccggc      1260
     atgcgctggg cgcgccggcc gaacccggag gtcttctacc ccgacgcgct catctcccgc      1320
     gcctccatcg ccgtgaagac gggcgacgtg gtgctgctcc gccgcgtcgc gcgcgaggat      1380
     ctgcagaagc gggagaggga gctcgggctg ggcaaggccg cctcggtgcc ggaggcggag      1440
     ctgctcttca ccctcgagca ggagcccaag ctgcagggcg cgctcgtctc ggtggacccg      1500
     tggaccggct acgtggtggc catggtgggc ggctacgact tcgacgcgtc cgagttcaac      1560
     cgcgccttcc aggcctgccg ccagccgggc tcggcgttca agcccctcgt ctacgccgcc      1620
     gccatcgaga agctcgactt cacgccggcc accatcctga ccgacgcgcc catcgtcttc      1680
     cgcgacgacg agaacagctg gaagccccag aactacgggc aggacttcaa gggcgacgtg      1740
     acgctgcgca ccgccctcgt ggactcgatg aacatcccgg cggtgaagac cgccgaggcg      1800
     ctctcggcga aggtcggcat gcaggccctc gccgagtggg cgaaggcgct cgggctcacc      1860
     acgcccgtga agctcgagct cgggaccgcg ctcggctcgt cgtgcgtgaa cctgtgggag      1920
     ctcacgaacg tgtacgcgct cttcgcgcgc tacggcgaga agcgccccgc caccttcgtg      1980
     aagcgggtgc tcgaccgcga cggcaacgtg ctcgaggacc gcaccgactg gcgcgatccc      2040
     tgggtcggcc tcgacgcgcg gctcgccgcc gggttcgcgg aggtgacgcg cccgcgcgcc      2100
     cgggtgatgg acgagcggac cgcctacatc ctggtgcggc tcctgcgcga ggtcgccacc      2160
     gtcggcaccg gcgcgcgggc ctcggccctc ggcaagcccg cggcgggcaa gaccggcacg      2220
     acgaacgact cgttcgacac ctggttcatg ggcttcaccc acgacctcgc caccggcgtg      2280
     tggctgggct acgacgtgaa cgtgacgccg ctcgggcggt acgagacggg cggccacgcg      2340
     gccctgccga tctggctgtc ctacatgcgc accgcgctcg accgccgccc gcagcccgag      2400
     ttcaccgcgc ccgccgggat cgtggaggtg cggatcgatc ccgacaccgg caagccggcg      2460
     gccgacggcg tgttcgagcc cttcaagcag ggcaccgagc cgagcgcgcc cgccgagggt      2520
     cagcagcagg tcgaggtgca ggacctgttc atgcagtag                             2559
//

If you have problems or comments...

PBIL Back to PBIL home page