(data stored in ACNUC7421 zone)

EMBL: CP000769.PE63

CP000769.PE63        Location/Qualifiers
FT   CDS_pept        79410..80222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0063"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: ade:Adeh_0061 sec-independent protein
FT                   translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24283"
FT                   /db_xref="GOA:A7H6D7"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D7"
FT                   /protein_id="ABS24283.1"
FT                   /translation="MSSTAPQLPPAGAAAPEPENEVRLTFMEHLRDLRKRLTHAILGVL
FT                   VGMLAVGGFVDGIFHWLMAPVRAALPPNQQVLHYTSSIEPLMVYLKVAVYGGVFVAAPW
FT                   VLYQLWQFVAPGLYKKEKRLVIPFLFFGTLLFYVGAAFCYFLVMPPAFPAMLAVAADAS
FT                   LAPMLTMSSTLGLVLAMLLGFGVVFEVPVILAFLSLIGVVSAQTLAKYRRVAIIVNVLV
FT                   AAVITPTGDPLNLAMMAVPMIVFYEIGILLARILGKRKAEPVGAAANP"
     atgagctcga ccgcgccgca gctccccccc gccggtgccg cagcgccgga gccggagaac        60
     gaggtccggc tcacgttcat ggagcacctc cgcgacctgc ggaagcggct cacccacgcc       120
     atcctcggcg tgctcgtggg catgctcgcg gtgggcgggt tcgtggacgg gatcttccac       180
     tggctcatgg ccccggtgcg cgccgccctg ccgccgaacc agcaggtgct gcactacacg       240
     agctcgatcg agccgctcat ggtgtacctg aaggtggccg tgtacggcgg cgtgttcgtg       300
     gccgcgcctt gggtgctgta ccagctgtgg cagttcgtcg ccccgggcct gtacaagaag       360
     gagaagcggc tcgtcatccc gttcctgttc ttcgggacgc tgctcttcta cgtcggcgcg       420
     gcgttctgct acttcctcgt catgccgccg gcgttccccg cgatgctcgc cgtcgcggcc       480
     gacgcgagcc tcgccccgat gctcaccatg agctccaccc tggggctcgt gctcgccatg       540
     ctgctcggct tcggcgtcgt gttcgaggtc ccggtcatcc tcgccttcct ctcgctcatc       600
     ggggtggtct cggcgcagac gctcgccaag taccggcggg tggcgatcat cgtgaacgtg       660
     ctcgtcgcgg cggtgatcac ccccaccggc gatccgctga acctcgccat gatggccgtg       720
     ccgatgatcg tgttctacga gatcgggatc ctcctcgcgc gcatcctcgg caagcgcaag       780
     gccgagccgg tgggcgcggc cgccaatccg tag                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page