(data stored in ACNUC7421 zone)

EMBL: CP000769.PE67

CP000769.PE67        Location/Qualifiers
FT   CDS_pept        complement(82789..85368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24287"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E1"
FT                   /protein_id="ABS24287.1"
FT                   /translation="MPDPRSVMQEFRTLDAKRRAGKLSPEEERRLAELRDLVGGDAGGG
FT                   APRGGFDVNAAAARLRESLLPAGLRNRPPPPPELSPEPEPEPFFPASAPPVALEAAPAE
FT                   PAGENPLADLDPSALFDPATLGWEGELGAQPPYDPAALPQETAAWDPNAAAPPWDPGAA
FT                   SQDPASWDPNAPEGAQAWDPAAIPQDAAWDPSAGAEGQPWDPATLADETAAWAPDALPA
FT                   DPGAPPAWDPASAAGWDPSGDAAASPTPDDAAAWSGADGAAAPLDPAALAGAPALAYDD
FT                   AGLPEAGLQPAGIAPEPFDLSALGGEGEAAWDPASLAADGAAEPAFDGGWDAGLAPEAE
FT                   PEPTRAFPLGAAAPAGALEELPALDLDAADLDLLGLEDVALAAEPEGAELDPASAPEPT
FT                   QLLGLASEPEPTQTLPLGGDASTLPPAGWDPTPPPAPSAPGAPLGAYDEDPGAGASAFG
FT                   PDDGLSLDAGFSAEPGAPIDATAAFALGEYDDTAAFAPGAVFEPPADGFEAGEPLALDP
FT                   DGSALDGAGDWPPGAALDPDFSLASGGSFDAADPGAAWATAEAPAPWELAAGAAAAPVA
FT                   HADATPDAAEADSVTESHSLVPVSAAAPDGDDLSLPEIVEEIPTVDGEEILEEIPADEA
FT                   DLPPPALDFAAPATAAAPRPAAAPPAAVPAPAPRPAAATSTAPAAPAAPAPRAATPAAP
FT                   AAVAPPPALSPARGAAVPAPPSAPEPPRAAAMPARAASPAGPTVASGTQRVVVHTLEGT
FT                   VKRGVVEDLDLAAPALALLPAPGAAGETIATEKVKAIFFMLAPGEPTPAAEGKKVRVTF
FT                   RDGRQVAGYSPDYREDGPGFFMVPGDTRTNTGRIWVYRAAVKEVSVS"
     atgcccgatc cgcgcagcgt catgcaggag ttccggaccc tcgacgcgaa gcgccgcgcg        60
     ggaaagctct cgccggagga ggagcgccgc ctcgccgagc tgcgcgatct cgtgggcggc       120
     gacgcgggcg ggggagcgcc gcgcggcggc ttcgacgtga acgcggccgc ggcccggctg       180
     cgcgagtcgc tgctccccgc ggggctgcgg aaccgaccac cgccgccgcc cgagctctcg       240
     cccgagcccg agcccgagcc gttcttcccg gcgtccgcgc cgccggtcgc gctcgaggcg       300
     gcgccggccg agccggcggg ggagaacccg ctcgccgacc tcgacccctc cgccctgttc       360
     gatcccgcca cgctcggctg ggagggcgag ctcggcgcgc agccccccta cgatcccgcc       420
     gccctcccgc aggaaacggc cgcctgggat ccgaacgccg ccgcgccgcc gtgggatccg       480
     ggcgcggcct cgcaggatcc ggcctcctgg gacccgaacg ctcccgaggg cgcccaggcc       540
     tgggatccgg ccgcgatccc gcaggacgcc gcctgggacc cgagcgccgg cgcggaggga       600
     cagccctggg atcccgccac cctcgcggac gaaacggccg cctgggctcc ggacgcgctc       660
     cccgcggacc ccggcgcgcc gccggcgtgg gatccggcga gcgcggccgg ctgggatcct       720
     tcgggtgacg cggccgcttc gcccaccccg gacgacgcgg cggcgtggag cggcgcggac       780
     ggcgcagcgg ccccgctcga tccggcggcg ctcgcgggag cgcccgccct cgcgtacgac       840
     gacgccgggc tccccgaggc cggcctgcaa ccggccggca tcgcgcccga gcccttcgac       900
     ctgtccgccc tcggcggcga gggggaggcc gcgtgggatc ccgcctcgct cgcggccgac       960
     ggggcggcag agcccgcctt cgacgggggc tgggatgccg gactcgcgcc ggaggccgag      1020
     cccgagccga cgcgggcgtt cccgctcggc gccgcggcgc ccgccggagc gctcgaggag      1080
     ctgcccgcgc tggatctgga cgcagccgac ctggacctcc tgggcctcga ggacgtcgcg      1140
     ctggccgccg agccggaggg cgccgagctc gatccggcct cggcgcccga gccgacccag      1200
     ctgctggggc tcgcgagcga gccggagccc acgcagacgc tgccgctcgg cggcgatgcc      1260
     tccacgctcc ctcccgccgg ctgggatccc acgccgccgc ccgctccctc cgcgccgggc      1320
     gcgccgctcg gcgcgtacga cgaggacccc ggcgccggcg cgtccgcgtt cggcccggac      1380
     gacggcctct cgctcgacgc cgggttctcc gcggagcccg gcgctcccat cgacgcgacc      1440
     gccgcgttcg cgctgggcga gtacgacgac accgccgcgt tcgcgccggg ggcggtgttc      1500
     gagccccccg ccgacgggtt cgaggccggc gagcccctcg cgctcgaccc ggacggctcc      1560
     gcgctggacg gggcgggcga ctggccgccg ggcgccgcgc tcgaccccga cttctcgctc      1620
     gcgtccggtg gctcgttcga cgccgccgat ccaggcgccg cgtgggcgac cgccgaggcg      1680
     cccgcgccct gggagctcgc cgccggcgcg gcggcggcgc ccgtcgcgca cgccgacgcc      1740
     acgccggacg ccgccgaggc ggactccgtc acggagagtc actccctcgt gccggtctcc      1800
     gcggcggcgc ccgacgggga cgatctctcg ctgcccgaga tcgtcgagga gatcccgacg      1860
     gtggacgggg aggagatcct cgaggagatc ccggccgacg aggcggacct cccccctccc      1920
     gcgctcgact tcgccgctcc ggcgaccgcc gccgctccgc gccccgccgc cgccccaccc      1980
     gccgcggtcc cggcgcccgc cccacggccg gccgctgcga cgtccaccgc gcccgccgcg      2040
     ccagccgctc cagcgccgcg cgccgcgacg ccagccgccc ccgcggcggt ggcgccgcct      2100
     ccggcgctct cgccggcgcg cggcgccgcg gtgcccgcgc cgccctccgc gcccgagccc      2160
     ccgcgggccg ccgcgatgcc ggcgcgcgcc gcctcgcccg cgggaccgac cgtcgcctcg      2220
     ggcacgcagc gggtggtggt gcacacgctg gagggcacgg tgaagcgcgg cgtcgtcgag      2280
     gacctcgacc tcgccgcccc ggccctcgcg ctcctccctg cacccggcgc cgccggggag      2340
     acgatcgcga ccgagaaggt gaaggcgatc ttcttcatgc tcgcccccgg cgagcccacc      2400
     cccgcggccg aggggaagaa ggtgcgcgtg acgttccgcg acggccggca ggtggcgggc      2460
     tacagcccgg actaccgcga ggacggcccg ggcttcttca tggtccccgg cgacacgcgc      2520
     accaacaccg gccggatctg ggtctaccgg gcggcggtga aggaagtgtc cgtgagctga      2580
//

If you have problems or comments...

PBIL Back to PBIL home page