(data stored in ACNUC7421 zone)

EMBL: CP000769.PE69

CP000769.PE69        Location/Qualifiers
FT   CDS_pept        87457..88191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0069"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   ade:Adeh_0068 lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24289"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E3"
FT                   /protein_id="ABS24289.1"
FT                   /translation="MIPHRGRAALAAALLLLAGAARAQLPERPKAGRGAPIAYLAMGDS
FT                   TAVGVGGGAGGGYPQRLARRLEASGVPVKLAVVAASGATIADLRRDQLPEVMAKRPALV
FT                   TIGVGINDLMQGRKLADFARDLEVVADLVRRTKATVVLQTLPDLTFSPAGHGAPPSLGR
FT                   RLEAYNATIARVAERHGFVLSDVYGKSRRAFRDRQAELFAKDGFHPSSAGYEVWTEALW
FT                   PDVERAVVAPRVQARTPAAGER"
     gtgatcccgc accgtggccg tgccgcgctc gccgccgcgc tcctcctgct cgccggcgcc        60
     gcgcgcgccc agctcccgga gcggccgaag gccggccgcg gcgcgcccat cgcctacctg       120
     gccatgggcg actcgaccgc ggtgggggtg gggggcggcg ccggcggcgg ctacccgcag       180
     cggctcgcgc ggcggctcga ggcgagcggc gtcccggtga agctcgccgt ggtggcggcg       240
     tcgggcgcca ccatcgccga cctgcgccgc gaccagctcc cggaggtgat ggcgaagcgg       300
     ccggcgctcg tcaccatcgg cgtggggatc aacgacctca tgcaggggcg caagctcgcc       360
     gacttcgccc gcgatctcga ggtcgtcgcc gacctggtgc ggcgcaccaa ggcgaccgtg       420
     gtcctccaga cgctccccga cctcaccttc tcgcccgccg gccacggcgc gccgccctcg       480
     ctcggcaggc gcctcgaggc gtacaacgcc accatcgcgc gcgtcgccga gcggcacggc       540
     ttcgtgctct ccgacgtgta cggcaagagc cggcgcgcct tccgcgaccg ccaggccgag       600
     ctcttcgcga aggacggctt ccacccctcc tccgccggct acgaggtgtg gaccgaggcg       660
     ctctggccgg acgtggagcg cgcggtcgtc gctccgcgcg tgcaggcccg cacgcccgcc       720
     gcgggcgagc gctga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page