(data stored in ACNUC7421 zone)

EMBL: CP000769.PE72

CP000769.PE72        Location/Qualifiers
FT   CDS_pept        complement(90815..91090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24292"
FT                   /db_xref="InterPro:IPR014995"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E6"
FT                   /protein_id="ABS24292.1"
FT                   /translation="MDEKSAGGIDFYTFVLSLASSAFVHLGDAPHPDTGLPGKPDLALA
FT                   HQTIDILAMLREKTKGNLTAEEEQFIDHLLTDLRLRYVSRQGGKPE"
     atggacgaga agagcgccgg cgggatcgac ttctacacct tcgtgctgtc gctcgcctcg        60
     agcgcgttcg tccacctcgg cgacgcgccc caccccgaca ccgggctgcc cggcaagccc       120
     gacctcgccc tcgcgcacca gacgatcgac atcctcgcca tgctccgcga gaagacgaag       180
     ggcaacctca cggcggagga ggagcagttc atcgaccacc tcctcaccga cctgcggctg       240
     cgctacgtgt cgaggcaggg cggcaagccg gagtag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page