(data stored in ACNUC7421 zone)

EMBL: CP000769.PE81

CP000769.PE81        Location/Qualifiers
FT   CDS_pept        99113..100504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0081"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   mxa:MXAN_1623 peptidase, M16 (pitrilysin) family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24301"
FT                   /db_xref="GOA:A7H6F5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F5"
FT                   /protein_id="ABS24301.1"
FT                   /translation="MKPVLPLALALAALACASSRGAAGGAEPARATRLSVPLEYHTLEN
FT                   GLRVVLSPERSVPKVAVGVYYGIGFRVEPKDRTGFAHLFEHMMFQGSRSLGKMEFIKLV
FT                   QSNGGTLNGSTRFDFTNYFEVVPSNVLETILWAEADRMRGLAVTQENLANQQGVVANEV
FT                   KVNVLNRPYGGFPWLDLPQVANENWYNAHNFYGDLADLEAATLADVRRFFETYYAPNNA
FT                   VVALVGDFEPKEALAWVERHFGDIRPASQPPRPDLSEPRQEREKRAEKVDPLAERPAVA
FT                   LAWHAPARNTPAHAAFVLLDQMILQGRDSALYQKLVQEQGLTGEVSGGLNLLGNPWNYQ
FT                   GPMLHIAYLFHDKDRSAGEILRAVDEALAPYLERPVEPEALARAKVKARSALYAEMESF
FT                   AGFGLADLLAAHALFDDDPARVSRIEAELEAVTPALVLETAREYLRPTNRTVLLVKTKD
FT                   QGVAP"
     atgaagcccg tcctgccgct cgccctcgcg ctcgcagcgc tcgcgtgcgc ctcgtcccgc        60
     ggcgcggcgg ggggcgcgga gcccgcgcgc gccacgcgcc tctccgtgcc gctcgagtac       120
     cacacgctgg agaacggcct gcgggtggtg ctctccccgg agcggagcgt cccgaaggtc       180
     gcggtgggcg tctactacgg gatcggcttc cgcgtggagc cgaaggaccg caccggcttc       240
     gcccacctct tcgagcacat gatgttccag ggctcgcgga gcctggggaa gatggagttc       300
     atcaagctcg tgcagtcgaa cggcgggacg ctcaacggct ccacccgctt cgacttcacg       360
     aactacttcg aggtggtccc ctccaacgtc ctcgagacga tcctgtgggc ggaggccgac       420
     cggatgcgag gcctcgcggt gacccaggag aacctcgcga accagcaggg cgtggtggcg       480
     aacgaggtga aggtcaacgt gctgaaccgc ccgtacggcg ggttcccctg gctcgacctg       540
     ccgcaggtcg cgaacgagaa ctggtacaac gcgcacaact tctacggcga cctcgccgac       600
     ctcgaggcgg cgacgctcgc cgacgtgcgg cggttcttcg agacctacta cgcgcccaac       660
     aacgcggtgg tggcgctcgt gggggacttc gagccgaagg aggcgctcgc ctgggtggag       720
     cggcacttcg gcgacatccg cccggccagc cagccgccgc gcccggatct ctccgagccg       780
     cggcaggagc gggagaagcg ggccgagaag gtggatccgc tcgcggagcg gcccgccgtc       840
     gcgctcgcct ggcacgcgcc ggcgcggaac acgcccgcgc acgccgcctt cgtcctcctc       900
     gaccagatga tcctgcaggg gcgggactcg gccctgtacc agaagctcgt gcaggagcag       960
     gggctcaccg gcgaggtgtc gggggggctg aacctcctcg gcaacccgtg gaactaccag      1020
     ggcccgatgc tccacatcgc ctacctcttc cacgacaagg accgctccgc cggcgagatc      1080
     ctgcgcgcgg tggacgaggc gctcgcgccg tacctcgagc ggccggtgga gcccgaggcg      1140
     ctcgcgcggg ccaaggtgaa ggcgcgctcc gcgctctacg cggagatgga gagcttcgcc      1200
     ggcttcggcc tcgccgacct cctcgccgcc cacgcgctgt tcgacgacga ccccgcccgc      1260
     gtgagccgga tcgaggccga gctcgaggcg gtcacgccgg cgctggtcct cgagaccgcg      1320
     cgcgagtacc tccgcccgac gaaccgcacc gtgctcctcg tgaagaccaa ggaccagggg      1380
     gtcgccccgt ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page