(data stored in ACNUC7421 zone)

EMBL: CP000769.PE82

CP000769.PE82        Location/Qualifiers
FT   CDS_pept        100501..101934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0082"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   mxa:MXAN_1624 peptidase, M16 (pitrilysin) family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24302"
FT                   /db_xref="GOA:A7H6F6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F6"
FT                   /protein_id="ABS24302.1"
FT                   /translation="MTVLAAALALALAAQDPAAAAPKQAPPPPRPPPDFRVPGTRSFTL
FT                   DNGLAVTLVEMGQLPKATVALVLRAGTGDDPLEKTGLSSFLGALLTEGTTTRSAADIAA
FT                   AAARWGGAIETNVTPDETVVGGTVLSEFAPELVALVADVALNPAFPPREVERVRQDTLR
FT                   AVTIARTQPQVLAQERFLASLYPDHPYGRLLPTPEIVRGYTVDEARAFHRASYGARRAH
FT                   LYVAGRFDRAATEARIRAALAAMPPGAPREPTPPRPASRRAVELVPRPGAVQSSLYLGL
FT                   PVLDPRHPDYLRLAVANTLLGGYFSSRITANIREAKGYTYSPYSLVSVRAGTGYWAQVA
FT                   DVTTAVTGASLKEIFAEVERLRAAPPGADELRAVQAYLAGTFVLQTSDRDGLIARLRFV
FT                   DLHGLGERWLEEYVKNVRAVTPADAQRMAQAWLDPARITVVVVGDPALVTEQVRPFGEI
FT                   VTAPAAPQPDAAAPSKPRT"
     gtgaccgtcc tcgccgccgc cctcgccctc gccctcgccg cccaggaccc cgccgcggcc        60
     gcgccgaagc aggcgccgcc gccgccgcgt ccgccgccgg acttccgcgt gccggggacg       120
     cgctcgttca cgctcgacaa cggcctcgcc gtcacgctcg tcgagatggg ccagctcccc       180
     aaggccaccg tggcgctggt gctgcgcgcc ggcacgggcg acgaccccct ggagaagacg       240
     gggctctcga gcttcctcgg ggcgctcctc accgagggga cgaccacccg cagcgccgcg       300
     gacatcgccg cggccgcggc gcgctggggc ggcgccatcg agacgaacgt gacgcccgac       360
     gagacggtgg tcggcggcac ggtgctgtcc gagttcgccc ccgagctcgt cgcgctcgtc       420
     gccgacgtgg cgctcaaccc ggccttcccg ccgcgcgagg tggagcgcgt gcgccaggac       480
     accctgcgcg ccgtgaccat cgcccgcacg cagccgcagg tgctggcgca ggagcggttc       540
     ctcgcgtcgc tctaccccga tcacccgtac ggcaggctcc tccccacgcc ggagatcgtg       600
     cgcggctaca cggtcgacga ggcgcgggcg ttccaccggg cgagctacgg cgcgcgccgc       660
     gcccacctct acgtggccgg acgcttcgac cgggcggcga ccgaggcgcg gatccgcgcc       720
     gcgctcgccg ccatgccgcc gggcgccccg cgcgagccga cgccgccgcg gccggcctcg       780
     cgccgcgcgg tcgagctcgt cccgcgcccc ggggcggtcc agtcttccct ctacctcggc       840
     ctgcccgtgc tcgacccgcg ccacccggac tacctccggc tcgcggtcgc gaacacgctc       900
     ctcggcggct acttctcctc ccgcatcacc gccaacatcc gcgaggcgaa gggctacacc       960
     tactccccgt acagcctggt ctcggtgcgg gccgggacgg ggtactgggc gcaggtggcc      1020
     gacgtgacga cggcggtgac cggcgcgtcg ctgaaggaga tcttcgccga ggtggagcgg      1080
     ctgcgcgccg cgccgccggg ggctgacgag ctccgcgcgg tccaggcata cctcgccggc      1140
     accttcgtgc tgcagacctc cgatcgcgac gggctcatcg cgcgcctgcg cttcgtcgat      1200
     ctgcacgggc tcggggagcg ctggctcgag gagtacgtga agaacgtgcg ggcggtgacg      1260
     cccgcggacg cgcagcgcat ggcgcaggcc tggctcgacc cggcgcggat caccgtggtg      1320
     gtggtgggcg acccggccct ggtgaccgag caggtgcggc cgttcggcga gatcgtcacc      1380
     gccccggccg cgccgcagcc ggacgccgcg gcgccttcga agccgcggac ctga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page