(data stored in ACNUC7421 zone)

EMBL: CP000769.PE83

CP000769.PE83        Location/Qualifiers
FT   CDS_pept        102060..102458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0716 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24303"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F7"
FT                   /protein_id="ABS24303.1"
FT                   /translation="MSEEIAHDIRAFLLAYVESYEQLEILLLLHREAAAWQPPGVADAL
FT                   KIPLSSAAASLDELAARGLLRRERGGYRFDPGDPSVACLVAGLARAYEERRVAVIDLMS
FT                   ANAMDRIRRSALRTFAEAFRLRGTKKDG"
     ttgagcgagg agatcgcgca cgacatccgg gcgttcctgc tggcgtacgt ggagtcgtac        60
     gagcagctcg agatcctgct cctgctgcac cgcgaggcgg ccgcgtggca gcctcccggc       120
     gtggcggacg cgctcaagat cccgctctcg tcggccgccg cctcgctgga cgagctcgcc       180
     gcgcgcggcc tgttgcgccg cgagcgcggg ggctaccgct tcgacccggg ggatccgtcc       240
     gtcgcttgcc tcgtcgcggg cctggcgcgc gcctacgagg agcgccgggt ggcggtgatc       300
     gatctcatga gcgccaacgc catggaccgc atccggaggt cggcgctccg caccttcgcg       360
     gaggcgttcc ggctgagggg gacgaagaag gatggctga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page