(data stored in ACNUC7421 zone)

EMBL: CP000769.PE88

CP000769.PE88        Location/Qualifiers
FT   CDS_pept        108328..109401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0088"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ade:Adeh_0086 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24308"
FT                   /db_xref="GOA:A7H6G2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G2"
FT                   /protein_id="ABS24308.1"
FT                   /translation="MLHEARYWEPAEGGRVLCTLCPRACRIGDGQAGFCFIRQNRGGRL
FT                   LTAGYGRSTGFAVDPVEKKPLAHWLPGSAVLSFGTAGCCLGCRFCQNWDISKARLDDRA
FT                   AEDRWSPERVAALAVEAGAAGVAFTYNDPIIWAEYAIDVAEAAHARGLYTVFVTSGYVE
FT                   PAARAEIFRHMDATNVDLKAFTEDFYAKVTLAHLAPVLDTLEWLARETDVWVEVTNLLI
FT                   PGLNDAEDETRRLADWVAAHMGVDVPLHFTAFHPDYKLRDRPRTPPRTLSHARELARAA
FT                   GLRHVYTGNVHDPEGQTTFCPRCGARVIERDWHAVRAVRMARGACAACGERIAGRFADG
FT                   PVAPTSGRRVALGLPDA"
     gtgctccacg aggcgcgcta ctgggagccc gccgagggcg ggagggtgct gtgcacgctc        60
     tgcccgcgcg cctgtcgcat cggggacggc caggccggct tctgcttcat ccgacagaac       120
     cgcgggggac ggctgctcac cgccggctac ggccgctcca cgggcttcgc cgtggatccc       180
     gtcgagaaga agccgctcgc ccactggctg ccgggctcgg cggtgctgtc cttcggcacc       240
     gcggggtgct gcctgggctg ccgcttctgc cagaactggg acatctcgaa ggcccgcctc       300
     gacgatcgcg ccgcggagga tcgctggtcg ccggagcgcg tcgcggcgct cgcggtcgag       360
     gcgggcgcgg cgggggtggc cttcacgtac aacgacccca tcatctgggc ggagtacgcc       420
     atcgacgtgg ccgaggcggc gcacgcgcgc ggcctctaca ccgtgttcgt gacgagcggc       480
     tacgtggagc ccgcggcgcg cgcggagatc ttccgccaca tggacgcgac gaacgtggac       540
     ctgaaggcgt tcaccgagga cttctacgcg aaggtgaccc tcgcgcacct cgcgccggtg       600
     ctcgacacgc tcgagtggct cgcccgcgag acggacgtct gggtggaggt cacgaacctc       660
     ctcatcccgg gcctcaacga cgcggaggac gagacgcgcc gcctcgccga ctgggtcgcc       720
     gcgcacatgg gcgtcgacgt ccccctccac ttcaccgcct tccaccccga ctacaagctg       780
     cgcgatcggc cccgcacgcc tccccgcacg ctctcgcacg cgcgtgagct cgcgcgggcg       840
     gccgggctgc gccacgtcta cacgggcaac gtgcacgatc ccgagggcca gaccaccttc       900
     tgcccgcgct gcggcgcccg cgtcatcgag cgcgactggc acgcggtgcg ggcggtgcgg       960
     atggccaggg gcgcctgcgc ggcgtgcggc gagcggatcg cggggcgctt cgccgacggg      1020
     ccggtggcgc cgacctcggg caggcgcgtc gcgctggggc tgccggacgc gtga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page