(data stored in ACNUC7421 zone)

EMBL: CP000769.PE89

CP000769.PE89        Location/Qualifiers
FT   CDS_pept        complement(109424..109720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24309"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G3"
FT                   /protein_id="ABS24309.1"
FT                   /translation="MRRLVTALAFALLSACTEPCQELANRFCECAGGGSSQDSCERGAE
FT                   DRLSDVGAGDAKQKQCEGWLDTCHAPSGAEFCEWISTADAKEKCGISLAADAP"
     atgcgccgcc tcgtcaccgc cctcgccttc gccctcctct ccgcctgcac cgagccttgc        60
     caggagctcg cgaaccgctt ctgcgagtgc gcgggcggcg gcagctcgca ggactcctgc       120
     gagcgcggcg cggaggaccg gctctccgac gtgggcgccg gcgacgccaa gcagaagcag       180
     tgcgaggggt ggctcgacac ctgccacgcc ccgtcgggcg ccgagttctg cgagtggatc       240
     tccacggcgg acgccaagga gaagtgcggc atctcgctcg cggcagacgc tccctga          297
//

If you have problems or comments...

PBIL Back to PBIL home page