(data stored in ACNUC7421 zone)

EMBL: CP000769.PE90

CP000769.PE90        Location/Qualifiers
FT   CDS_pept        109810..110433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0090"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: ade:Adeh_0088 outer membrane lipoprotein
FT                   carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24310"
FT                   /db_xref="GOA:A7H6G4"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G4"
FT                   /protein_id="ABS24310.1"
FT                   /translation="MIAALAALLLAAAPPPADAGQLARKVQTFYERTRDLEARFQQTYT
FT                   YSGFGRRQVSAGTLKVKKPGMMRWDYETPAPKTVAVKGSRLVQFEPEENQAYVDERFDA
FT                   TAMSAAVTFLLGKGDLAREFGLSTDGTGALVLRPKEEDPRVESIALTVGPDGEVRATRV
FT                   VDGAGNVNEIRFEKVKRNAGLPDGAFEVKLPKDVRRIAPPGAER"
     atgatcgccg ccctcgccgc cctcctcctc gccgccgccc cgccgcccgc cgacgcgggc        60
     cagctcgctc gcaaggtcca gaccttctac gagcgcaccc gcgatctgga ggcccggttc       120
     cagcagacct acacctactc cggcttcggg cgccgccagg tctcggcggg tacgctcaag       180
     gtgaagaagc ccggcatgat gcgctgggac tacgagacgc ccgcgccgaa gaccgtggcg       240
     gtgaaggggt cgcgcctcgt gcagttcgag cccgaggaga accaggcgta cgtggacgag       300
     cgcttcgacg cgaccgccat gagcgcggcg gtcacgttcc tcctcggcaa gggcgacctc       360
     gcccgcgagt tcggcctctc caccgacggg acgggggcgc tggtgctccg cccgaaggag       420
     gaggacccgc gggtcgagtc gatcgcgctc accgtggggc cggacggcga ggtgcgcgcc       480
     acgcgggtcg tggacggggc cggcaacgtg aacgagatcc gcttcgagaa ggtgaagcgg       540
     aacgccgggc tccccgacgg ggccttcgag gtgaagctgc ccaaggacgt gcgccgcatc       600
     gcgccgcccg gcgcggagcg gtag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page