(data stored in ACNUC7421 zone)

EMBL: CP000769.PE95

CP000769.PE95        Location/Qualifiers
FT   CDS_pept        complement(115040..115528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0095"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   ade:Adeh_0094 protein of unknown function DUF520"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24315"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6G9"
FT                   /protein_id="ABS24315.1"
FT                   /translation="MPSFDVVSELNLMEVENAFNQARKEILQRFDFKGTSTDLERDKDE
FT                   NVVVKAGSEGRAEAALQVLMEKLAKRGVPLEGLDPQKLEPASGGSVRQLVKLKRGLKQE
FT                   DAKRIVALMKESGLKVQAAIQGEAVRISGKKKDDLQAAMQAIRTGGLGVPLQFQNFRE"
     atgccgagct tcgacgtggt ctccgagctg aacctcatgg aggtggagaa cgccttcaac        60
     caggcgcgca aggagatcct gcagcgcttc gacttcaagg ggacgagcac ggacctcgag       120
     cgcgacaagg acgagaacgt ggtggtgaag gccggctcgg aggggcgcgc ggaggcggcg       180
     ctgcaggtgc tcatggagaa gctcgccaag cgcggcgtgc cgctcgaggg cctcgacccg       240
     cagaagctcg agcccgcctc cggcggctcg gtgcgccagc tcgtgaagct gaagcggggc       300
     ctgaagcagg aggacgcgaa gaggatcgtc gccctcatga aggagagcgg cctcaaggtc       360
     caggccgcca tccaggggga ggcggtgcgc atcagcggca agaagaagga cgacctgcag       420
     gcggcgatgc aggccatccg gacggggggc ctgggggtgc cgctccagtt ccagaacttc       480
     cgggagtga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page