(data stored in ACNUC7421 zone)

EMBL: CP000769.PE96

CP000769.PE96        Location/Qualifiers
FT   CDS_pept        complement(115610..117262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0096"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase; KEGG:
FT                   ade:Adeh_0095 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24316"
FT                   /db_xref="GOA:A7H6H0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H0"
FT                   /protein_id="ABS24316.1"
FT                   /translation="MAPPVRIVPLGGLGEIGMNCMAIEADGRMAVVDCGILFPNEPIGV
FT                   DVIAPDLGWLRERREQVGAIYLTHGHEDHIGALPFLLREVKAPVYGTRFTLALLRPRLE
FT                   EAGVEADLREVAPGDARPAGEASPLSAEFYAVTHSIPDACGLALSTPQGTILHSGDFKI
FT                   DPRPISGPGFDLARVEALGRRGVRLLLSDSTNSERPGSSLSEAEVGAALEEAFERAPAR
FT                   VFVACFASNIHRIQQVANAARAFGRRLALLGRSMETNVRLAQALGYLELPGWMPVGFPE
FT                   ARELPPKELCVLTTGTQGEPRSALARLARGEHLDLDVAPGDLVVLSSRFIPGNEVAVGE
FT                   LVNALCRRGAQVAYEGLRPLHVSGHAQEAEQRRLIALARPEHFVPIHGEYRHLARHAAH
FT                   AAAEGVRGRHLLLDGQVLELGDLGATVLEEPVPVGRVYTDRDALLGQDIGALVVKDRRL
FT                   LAEAGLCIAVLAVDKVTGAVIRGPELFARGVAGFEGAEEEIRAEALRALDELTPQARVA
FT                   IEEVQETLRVAVRRFLKRTTGKRPTVLPVVLEL"
     gtggcgcccc ccgtccgcat cgtgccgctc ggcggcctcg gcgagatcgg catgaactgc        60
     atggcgatcg aggccgacgg ccggatggcc gtggtggact gcgggatcct cttcccgaac       120
     gagcccatcg gcgtggacgt gatcgcgccg gacctcggct ggctgcgcga gcggcgcgag       180
     caggtcggcg ccatctacct gacccacggg cacgaggatc acatcggcgc gctgccgttc       240
     ctgctgcgcg aggtgaaggc gccggtctac ggaacgcgct tcacgctcgc gctcctgcgc       300
     ccgcggctcg aggaggcggg cgtcgaggcg gacctgcgcg aggtggcgcc cggcgacgcg       360
     cgaccggcgg gcgaggcgtc tcccctctcg gccgagttct acgccgtcac ccactccatc       420
     cccgacgcgt gcgggctcgc gctgtcgacg ccccagggca cgatcctcca ctccggggac       480
     ttcaagatcg acccgcgccc gatctccggg cccggcttcg atctcgcccg cgtcgaggcg       540
     ctcggccgcc gcggcgtgcg cctcctgctc tccgactcga cgaactccga gcggccgggc       600
     tcctccctct ccgaggccga ggtcggggca gccctcgagg aggcgttcga gcgcgccccc       660
     gcacgcgtct tcgtcgcctg cttcgcctcc aacatccacc gcatccagca ggtggcgaac       720
     gccgcgcgcg cgttcggccg gcggctcgcg ctcctcggcc gctcgatgga gacgaacgtc       780
     cggctcgccc aggcgctcgg gtacctggag ctgcccggct ggatgccggt ggggttcccg       840
     gaggcgcgcg agctgccgcc gaaggagctc tgcgtcctca ccaccggcac ccagggcgag       900
     ccgcggagcg cgctcgcgcg gctcgcgcgc ggcgagcacc tggacctcga cgtcgcgccg       960
     ggtgatctcg tcgtcctctc ctcgcgcttc atcccaggca acgaggtggc ggtcggcgag      1020
     ctggtgaacg cgctctgccg gcgcggggcg caggtggcct acgaggggct ccggccgctg      1080
     cacgtgtccg gccacgccca ggaggcggag cagcggcggc tcatcgcgct cgcccggccc      1140
     gagcacttcg tccccattca cggagagtac cgtcacctcg cgcgccacgc ggcccacgcc      1200
     gccgcggagg gggtgcgcgg gcggcacctg ctcctcgacg ggcaggtcct cgagctcggc      1260
     gacctcggcg cgaccgtgct cgaggagccg gtcccggtcg ggcgcgtcta caccgaccgg      1320
     gacgcgctgc tcgggcagga catcggcgcg ctcgtggtga aggaccggcg cctgctcgcc      1380
     gaggccgggc tctgcatcgc ggtgctcgcc gtggacaagg tgaccggcgc ggtgatacgc      1440
     gggccggagc tcttcgcccg gggcgtcgcc gggttcgagg gggcggagga ggagatccgg      1500
     gcggaggcgc tgcgcgccct cgacgagctc acgccgcagg cccgcgtggc gatcgaggag      1560
     gtgcaggaga cgctccgggt cgcggtccgc cgcttcctga agcgcaccac ggggaagcgg      1620
     cccacggtgc tgccggtggt gctggaactc tag                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page