(data stored in ACNUC7421 zone)

EMBL: CP000769.PE99

CP000769.PE99        Location/Qualifiers
FT   CDS_pept        complement(121028..122860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0099"
FT                   /product="Spore coat protein CotH"
FT                   /note="PFAM: Spore coat protein CotH; KEGG: ade:Adeh_3317
FT                   spore coat assembly protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24319"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H3"
FT                   /protein_id="ABS24319.1"
FT                   /translation="MVLPAGGLPVRPRRIARCPVNRQAPFLVAAILSLACGRGDGTTVV
FT                   RPPDEQPPPYQPPQQQLPPPGPSWPVASAPGAFPTPEPRLRRVDLTLAPGDLAALEAEP
FT                   TWDVMYPATVALDGRAAEGLVRFRGASSRTRPQRSWRIDLDPGYALEGRDRFALLAEYD
FT                   DAAKLVERFAVDLYRALGLPVPFARYVKLYVNGAYRGVFLDMERVGGEYLVHHGHETDA
FT                   SLYRCGGRNCELKLLPRYEPAYQQDFTKTRNEALPWDDLDRLLETVSRTDDAELERRLG
FT                   EVMDLDAYLGNLAADELIANTVLEDARGYWLHELHRDVWTYVPWDLNNSQAYWSRDIAA
FT                   NAPLGGVWREAQIFSIYDDAVRRIYDVRVTERAGQKPTWSVLATRVWDHPALRARLLAK
FT                   LEAALAGPFTPERVGPYLEALWAAAGPEIVTDPFVDATRAQTVPSRLVTFVRDRRSVLL
FT                   GRLARLRAHGSGPLVVNEVGMPGGTGPGYVELYNRADVALDLSGAHVTDDLRAPGKYAL
FT                   PEGTTIPPRGHLLLVADGTPWPPPAGAPAGEPLRLPFVLSPAGGELGVFAPGTLHAPYD
FT                   LVYFGPRAEGGAYGRTGDGVEAWSDVARTPGAPN"
     gtggtcctcc ccgccggcgg cctcccggtt cgtccccggc ggatcgcacg ttgccccgtg        60
     aacaggcaag cccccttcct cgtggccgcc atcctctcgc tcgcctgcgg ccgcggcgac       120
     gggacgaccg tcgtgcgccc tcccgacgag cagccgccgc cgtaccagcc cccgcagcag       180
     cagctccctc ccccggggcc gtcctggccg gtggcgagcg cccccggcgc cttccccacc       240
     cccgagccgc gcctgcgccg cgtggatctc acgctcgcgc cgggcgacct cgccgcgctc       300
     gaggcggagc cgacctggga cgtcatgtac cccgcgaccg tggcgctcga cggccgcgcg       360
     gccgaggggc tcgtgcgctt ccgcggcgcc tcgtcccgca cgcgcccgca gcggagctgg       420
     cgcatcgacc tcgacccggg ctacgcgctc gaggggcgcg atcgcttcgc gctgctcgcc       480
     gagtacgacg acgcggcgaa gctcgtggag cgcttcgcgg tggacctcta ccgcgccctc       540
     ggcctccccg tccccttcgc ccgctacgtg aagctctacg tgaacggcgc ctaccgcggc       600
     gtgttcctcg acatggagcg ggtgggcggc gagtacctcg tccaccacgg gcacgagacc       660
     gacgcctccc tctaccgctg cggcggccgc aactgcgagc tgaagctgct cccccgctac       720
     gagccggcgt accagcagga cttcacgaag acgcgcaacg aggcgctccc ctgggacgac       780
     ctcgaccgcc tcctcgagac cgtcagccgg acggacgacg cggagctcga gcggcggctc       840
     ggggaggtga tggacctcga cgcctacctc ggcaacctcg cggcggacga gctcatcgcg       900
     aacaccgtcc tcgaggacgc ccgcggctac tggctccacg agctgcaccg cgacgtgtgg       960
     acctacgtcc cgtgggatct caacaactcg caggcctact ggtcgcgcga catcgccgcc      1020
     aacgcgcccc tcggcggcgt ctggcgcgag gcgcagatct tctccatcta cgacgacgcg      1080
     gtgcggcgga tctacgacgt gcgggtgacg gagcgcgccg ggcagaagcc gacctggagc      1140
     gtgctcgcca cgcgcgtctg ggatcacccg gcgctgcgcg cgcgcctgct cgccaagctc      1200
     gaggccgccc tcgcgggccc cttcaccccg gagcgggtgg gcccctacct cgaggcgctc      1260
     tgggcggcgg cgggcccgga gatcgtgacc gatccgttcg tggacgcgac gcgcgcgcag      1320
     acggtgccct cccgcctggt gacgttcgtc cgcgatcgcc ggagcgtcct cctcgggcgg      1380
     ctggcgaggc tgcgcgcgca cggctcgggt ccgctcgtgg tgaacgaggt cggcatgccc      1440
     ggcgggacgg ggcccggcta cgtggagctg tacaaccggg ccgacgtcgc gctcgacctc      1500
     tcgggcgccc acgtcaccga cgacctgcgc gcgccgggga agtacgcgct ccccgagggg      1560
     accacgatcc cgccgcgcgg gcacctgctg ctcgtcgcgg acggcacgcc ctggccgccg      1620
     ccggccgggg cgccggcggg cgagccgctg cgcctgccgt tcgtcctctc ccccgcgggc      1680
     ggcgagctcg gcgtgttcgc gccggggacg ctgcacgctc cgtacgatct cgtctacttc      1740
     ggcccgcgcg cggagggggg cgcctacggg cgcaccggcg acggcgtcga ggcgtggtcg      1800
     gacgtggcgc gcacgccggg ggcgccgaat tga                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page