(data stored in ACNUC7421 zone)

EMBL: CP000820.PE102

CP000820.PE102       Location/Qualifiers
FT   CDS_pept        complement(123040..123750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV1688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09571"
FT                   /db_xref="GOA:A8LBB0"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBB0"
FT                   /protein_id="ABW09571.1"
FT                   /translation="MQPPPSLPAQLYLLAYDLERNRMYRSPYLGRALRAAAATELYRAG
FT                   LLTDENGRVKPVAPRAEHRPHAEGRPGQPAAPGRRRTPTADELCAQLISEVGASSRHRS
FT                   WKHWVNKNQRTAGRVVRDQLEAGRWIRVERRRILGMIPATSVTVRDRAMVRRLHREVEQ
FT                   VLHGGPAGRADPGPASLAALLAAGQIGAMKSGRARRALKGRLALLEPVAGPAVPALRAA
FT                   VREAQTAESAGAAG"
     atgcaaccac caccgtcgct gccggcccag ctctacctgc tggcctacga cctggagcgg        60
     aaccgcatgt accgctcgcc ctatctgggt cgcgcgctac gcgcggccgc cgcgaccgag       120
     ctctaccggg ctggactgct gaccgacgag aacggccggg tcaagcccgt cgcgccccgt       180
     gcggagcacc ggccgcacgc ggaagggcgg ccgggccagc ctgctgcgcc gggccggcgg       240
     cgcaccccga ccgccgatga gctgtgcgca cagctcatca gcgaggtcgg cgcgtcgtcc       300
     cgtcaccggt cgtggaagca ctgggtgaac aaaaaccagc ggaccgccgg ccgggtcgtg       360
     cgcgaccagc tcgaggcggg ccgctggatc agggtcgagc gacgccggat cctggggatg       420
     atcccggcga cctccgtgac cgtgcgggac cgggcgatgg tccgccggct gcaccgcgag       480
     gtggagcagg tcctacacgg aggcccggcc ggccgcgccg accccggccc ggcgagcctg       540
     gccgcgctcc tcgccgccgg tcagatcggg gcgatgaaaa gcggccgggc ccggcgggca       600
     ctcaagggtc ggctcgcgct gctggaaccg gtcgccgggc cggccgtccc ggcgctgcgc       660
     gccgccgtgc gggaggcgca gaccgccgaa tcagccggtg cagccggttg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page