(data stored in ACNUC7421 zone)

EMBL: CP000820.PE107

CP000820.PE107       Location/Qualifiers
FT   CDS_pept        complement(127540..128625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0109"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   N-acetylmuramoyl-L-alanine amidase family 2; KEGG:
FT                   fal:FRAAL6784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09576"
FT                   /db_xref="GOA:A8LCD7"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCD7"
FT                   /protein_id="ABW09576.1"
FT                   /translation="MYGSSWDRTRNTESTAWGRPPGRRPRAAAGHPDTTQTRRGTRDSS
FT                   RPTATGTSSADRDPSTGGDPSAGRGPKAGRDPTADGVRARGEHERPGLTVAVTLYPPAR
FT                   NRPVRNTSGTMVEPTRGLIPHVQVGTGSLFGWFDNPASQVSAHLWLSKAGEFEQYVPFD
FT                   RRAWAQAAGNPFWISVECEGYDSEDYTAIQVQRLGELFAWGMREFGWRPEITDSPNGYG
FT                   LGTHRMGGAAWGGHSCPGNVRANRRGDILAAALGASPGGSLADPRQRYAGMPTLREGMS
FT                   GPEVVTLQNALNIIFGHEAPTGDPYRLAPDGAYGARTTARVASLQRYATPWFGRIPEDG
FT                   VCGPNTWRKIGYVLTGMNRQV"
     ttgtacggat cgtcatggga tcgcacgcga aacaccgaaa gcacggcctg gggccgacca        60
     ccaggacggc ggccacgggc cgcggcgggc cacccggaca ccacacagac acgaagagga       120
     acacgtgact cgtccagacc gacggcaacc ggtacgtcga gcgcagacag ggacccgagc       180
     accggcgggg acccgagcgc cggcaggggt ccgaaggccg gcagagaccc gactgccgac       240
     ggagtccggg cacgcggcga gcacgaacgg ccggggctga ccgtggccgt caccctctac       300
     ccaccggccc gcaaccgccc ggtccgcaac acgtccggga cgatggtgga gccgacccgc       360
     gggctgatcc cccacgtcca ggtcggcacc ggttcgctct tcggctggtt cgacaatccg       420
     gccagccagg tcagcgccca cctgtggctg tcgaaggcag gcgagttcga gcagtacgtc       480
     ccgttcgacc gccgggcctg ggcgcaggcc gcgggcaacc cgttctggat cagtgtcgag       540
     tgcgaggggt acgactccga ggactacacg gcgatccagg tacagcgcct cggcgagctc       600
     ttcgcctggg ggatgcgcga gttcggctgg cgccccgaga tcacggactc acccaacggc       660
     tacgggctcg gcacgcaccg catgggcggc gcggcgtggg gtggtcactc gtgcccgggg       720
     aacgtccgcg cgaaccgccg gggcgacatc ctcgcggccg cgctgggggc gtcccccggg       780
     ggctcgctcg cggacccgcg gcagcggtac gcggggatgc cgaccttgcg ggaggggatg       840
     agcgggccgg aggtggtcac cctgcagaac gcactgaaca tcattttcgg ccacgaggcg       900
     ccgacgggtg acccctaccg cctggcgccc gacggggcct acggcgcgcg caccaccgcc       960
     cgggtggcct cgcttcagcg gtacgcgacg ccgtggttcg gccgcatacc cgaggacggg      1020
     gtctgcggcc cgaacacctg gcgcaagatc ggctatgtcc tcaccgggat gaaccgccaa      1080
     gtgtga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page