(data stored in ACNUC7421 zone)

EMBL: CP000820.PE110

CP000820.PE110       Location/Qualifiers
FT   CDS_pept        complement(130611..132047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0112"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: fal:FRAAL6781 adenosylhomocysteinase
FT                   (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase); TIGRFAM:
FT                   adenosylhomocysteinase; PFAM: S-adenosyl-L-homocysteine
FT                   hydrolase; TrkA-N domain protein; D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09579"
FT                   /db_xref="GOA:A8LCE0"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE0"
FT                   /protein_id="ABW09579.1"
FT                   /translation="MTFDFKVADLALAEFGRKEIRLAEHEMPGLMATRAEYAASQPLKG
FT                   ARIMGSLHMTIQTAVLIETLVALGADVRWVSCNIFSTQDHAAAAVVVGPNGSKDDPKGV
FT                   PVFAWKGETLDEYWWCTDQALSWPDGGAPNMILDDGGDATLLVHKGAEFEKAGAVPATD
FT                   ASDSEEYAIVLETLRRTISEKPGRWTTTATSVKGVTEETTTGVHRLYEMAKAGTLAFPA
FT                   INVNDSVTKSKFDNKYGCRHSVIDGLNRATDVLIGGKVAVVAGYGDVGKGCADALRGQG
FT                   ARVIVTEIDPICALQAAMDGFQVATLEDVVSTADIFVTTTGNYDIITAAHMAAMKHQAI
FT                   VSNIGHFDNEIDMAGLTKTPGIEKINIKPQVDEWVFPDGHSIIVLAEGRLMNLGCATGH
FT                   PSFVMSNSFTNQVIAQIELFTKTEQYPVGVYTLPKHLDEKVARLHLDALGVKLTTLTKQ
FT                   QADYIGVPVEGPYKPDHYRY"
     atgactttcg acttcaaggt cgcggatctc gcgctggccg agttcggccg caaggagatc        60
     cggcttgccg agcacgagat gcccgggctg atggccaccc gcgccgagta cgcggccagc       120
     cagccactca agggcgcccg gatcatgggc tccctgcaca tgacgatcca gaccgcggtc       180
     ctgatcgaga cgctcgtcgc cctcggcgcg gacgtccggt gggtgtcctg caacatcttc       240
     tccacgcagg accacgccgc ggccgcggtg gtcgtcgggc cgaacggctc caaggacgac       300
     ccgaagggcg tgccggtctt cgcctggaag ggcgagaccc tcgatgagta ctggtggtgc       360
     accgaccagg cgctgtcctg gccggacggc ggcgcgccga acatgatcct cgacgacggc       420
     ggtgacgcca ccctgctcgt ccacaagggc gccgagttcg agaaggccgg cgccgtcccg       480
     gcgaccgacg cctcggactc cgaggagtac gcgatcgtcc tggagacgct gcgccgcacg       540
     atctccgaga agcccggccg ctggacgacg accgcgacgt cggtcaaggg tgtcaccgag       600
     gaaaccacca ccggcgtgca ccggctgtac gagatggcga aggccggcac gctcgccttc       660
     cccgccatca acgtgaacga ctcggtcacc aagtcgaagt tcgacaacaa gtacggctgc       720
     cgccactccg tcatcgacgg gctgaaccgg gcgaccgacg tgctcatcgg cggcaaggtc       780
     gcggtcgtcg ccggctacgg cgacgtcggc aagggctgcg cggacgcgct gcgcggccag       840
     ggcgcccgcg tcatcgtcac cgagatcgac ccgatctgcg cgctgcaggc cgctatggac       900
     ggcttccagg tcgccacgct cgaggacgtc gtctcgaccg ccgacatctt cgtgacgacc       960
     accggcaact acgacatcat cacggccgcg cacatggccg cgatgaagca ccaggcgatc      1020
     gtgtcgaaca tcgggcactt cgacaacgag atcgacatgg ccggcctcac gaagactccc      1080
     ggcatcgaga agatcaacat caagccgcag gtcgacgagt gggtgttccc ggacgggcac      1140
     tcgatcatcg tgctggccga gggccggctg atgaacctcg gctgcgccac cggccacccg      1200
     agcttcgtga tgtcgaacag cttcaccaac caggtgatcg cccagatcga gctgttcacc      1260
     aagaccgagc agtacccggt cggcgtctac acgctgccca agcacctgga cgagaaggtc      1320
     gcccggctgc acctggacgc cctgggcgtc aagctcacga cgctgacgaa gcagcaggcc      1380
     gactacatcg gcgtgccggt ggagggcccg tacaagccgg accactaccg ctactga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page