(data stored in ACNUC7421 zone)

EMBL: CP000820.PE113

CP000820.PE113       Location/Qualifiers
FT   CDS_pept        136246..137430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6775 conserved hypothetical protein;
FT                   putative membrane protein (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09582"
FT                   /db_xref="GOA:A8LCE3"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE3"
FT                   /protein_id="ABW09582.1"
FT                   /translation="MVSIPFPSHGRAGSATGSVTVGSGSAGWRATRTGRVAATTLFFVG
FT                   QVLLLAALYMIYRMGRQMAVGREPEALANARDVWSLERLLDLPNESAVQQLALHSTELL
FT                   ELANRFYIGVHFPASIAFLLWVMIRHRDHWPRVRTVILVSTGAALMIHILYPLAPPRFL
FT                   PQELPHVTLVDTGAVFGPSPYTAGDTVANQYAAMPSLHVGWSILVAWGVVSILRSRARW
FT                   LIIAHPVITTVVVVITGNHYWLDGVIGGSLVATAVQLTRLEAHARMRLWTIAAGQRLWG
FT                   RAGEATASLAGSPSGALGGVGVGAGVGNTTDADPRTGTDHGTGTDHPVSVPSSVVFAAV
FT                   LPAARGGPPRADLPAQRPFPPGPLPSGGTEPEDRPPTAARADVAAVESADGESG"
     atggtgagca ttccgtttcc ttcgcacggg cgggccgggt ccgcgaccgg gtctgtcacg        60
     gtcggctcgg ggagcgccgg gtggcgggcg acccgcaccg gtcgcgtggc ggccacgacg       120
     ctcttcttcg tcggccaggt gctgctgctc gccgcgcttt acatgatcta tcgcatgggg       180
     cggcagatgg ccgtcggccg ggagcccgag gcgctggcca acgcgcggga cgtctggagc       240
     ctggaacgcc tgctcgacct gcccaacgag tccgcggtcc agcaactcgc gctgcactcc       300
     acggagctgc tggagctggc gaaccgcttc tacatcgggg tccacttccc ggcgtcgatc       360
     gcgttcctgc tgtgggtgat gatccgccac cgggaccact ggccccgggt gcgcacggtg       420
     atccttgtgt cgaccggcgc cgcgctcatg atccacattc tgtacccgct ggcgccgccc       480
     cggttcctgc cgcaggagct gccgcacgtc accctcgtcg acaccggcgc ggtcttcggg       540
     ccgtccccgt acaccgccgg tgacacggtg gccaaccagt acgcggccat gccgagcctg       600
     cacgtcggct ggtcgatcct ggtcgcctgg ggagtggtga gcatcctgcg ctcacgcgcg       660
     cggtggctca tcatcgcgca cccggtgatc acaaccgtcg tcgtcgtgat caccgggaac       720
     cactactggc tggacggcgt gatcggcggc agcctggtgg ccacggcggt tcagctcacc       780
     cggctcgagg cgcacgcccg gatgcgactg tggaccatcg ccgccggcca gcggctgtgg       840
     ggacgggctg gtgaggccac cgcgtcgctt gccggctcgc cgtccggagc cctcggtggc       900
     gtgggtgtcg gcgcgggtgt cgggaacacg actgatgcgg atccgcggac tggaacagac       960
     cacgggacgg gtacggacca cccggtgagc gtgccctcct ccgtggtctt cgcggcggtg      1020
     cttcccgccg cgcgcggcgg gcctccccgc gctgacctgc ccgcacagcg tccgttccca      1080
     ccgggcccgc tcccatcggg cggcaccgag ccggaggacc gtccgcccac ggcggcgcgg      1140
     gccgacgtcg ccgcggtgga atccgccgac ggcgagagcg gctga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page