(data stored in ACNUC7421 zone)

EMBL: CP000820.PE115

CP000820.PE115       Location/Qualifiers
FT   CDS_pept        138819..140615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0117"
FT                   /product="peptidase C2 calpain"
FT                   /note="PFAM: peptidase C2 calpain; KEGG: fal:FRAAL6773
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09584"
FT                   /db_xref="GOA:A8LCE5"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE5"
FT                   /protein_id="ABW09584.1"
FT                   /translation="MSIKGQWIEGQWIEGQWIEGAPVAAAAAVLRRVAVESSSLLAPVI
FT                   VLDNDETWRSPWQRRCHGRIDEWTSALAAGARAAREQAVRLEFLAARGAWGAVTLGPAA
FT                   VSAPRSPVSHPAVVDVAFSPERLAELARRLRRAADDAARLAAEVRRVAHALPGDMGGAL
FT                   VAEGCCRGLDRVAAEAPDMAGAIDGRLAYAASGGSVASAGFGGSGGFATSAPAVERAPG
FT                   PEMQHAARLTEPRSAGADTARTVAELTASIGADPFRLDPRELSELSTRLGRLGPAELRA
FT                   VIGGLRGRPLEVLAAAVRIAPTRVELRTLGLLPAVFSLGDLLLRGAPASMVAEIARLFP
FT                   GLEPPMGGRYRPWAYTAGHPPSTGDLTMRDHGRDPVWASGVTPSDVGQGAVGDCYLLAA
FT                   LIGIAQADPGLLRRNLRENPNGTVSVTVHLPTGAVPVTVTRSLPARAGAGQEIAADADN
FT                   AAGEPELWAALYEKACARMAGSYARLEGGDPATAMEYLTGTAAVRRSPSAVGVDELAAR
FT                   LAAGGVVTVVTRSDLPPGCGLVPNHAYAVLKADARTGQALLRNPWDQAGTDDRLEWHDW
FT                   DGLKPALAGVQWASTGRGPPAR"
     ttgtcgatca aagggcagtg gatcgaaggg cagtggatcg aagggcagtg gatcgaaggg        60
     gctccggtcg ccgccgcggc ggcggtgctg cgccgggtcg cggtggagag ctcgtcgttg       120
     cttgcgccgg tgatcgtcct ggacaacgac gagacctggc ggtcaccctg gcagcgccgc       180
     tgccatggcc gcatcgacga gtggacgtcc gcgctcgcgg ccggcgcccg tgcggcgcgg       240
     gagcaggcgg tgcgtctgga gttccttgcg gctcggggcg cctggggagc cgtgacgctc       300
     gggccggcgg cggtgagcgc cccgcgctcg cccgtctctc atccggccgt cgtggacgtt       360
     gccttctctc cggagcggct cgcggagctg gcccgccggc tccggcgggc cgcggacgac       420
     gcggcccggc tcgcggccga ggttaggcgc gtcgcgcacg ccctgcccgg tgacatgggt       480
     ggtgccctgg tggcggaggg gtgctgtcgg ggcctcgacc gggtggcggc cgaggcaccc       540
     gacatggccg gcgccatcga cggcagactg gcctacgccg cgtctggcgg gtctgtcgcg       600
     tctgccgggt tcggcgggtc cggcgggttt gcgacatccg ctccggccgt ggagcgggcg       660
     ccgggtcccg agatgcagca cgccgcccgg ctcaccgaac cgcggtcggc gggcgcggac       720
     acagcgcgca ccgtggccga gctgaccgcg tcgatcggcg cggacccgtt ccgcctcgat       780
     ccgcgtgagc tgagcgagct gtccacccgg ctgggccggc tcggcccggc cgagctgcgg       840
     gcggtcatcg gcgggctgcg ggggcgcccg ctggaggtgc tcgccgccgc ggtccgtatc       900
     gcgccgaccc gggtggagct gcgcacgctg ggcctcctgc cggccgtctt ctcccttggt       960
     gacctgctcc tgcgcggggc gccggcgtcg atggtggccg agatcgcgcg gctgttcccc      1020
     ggcctcgaac cgcccatggg cgggcggtac cggccgtggg cgtacaccgc ggggcatccg      1080
     ccgtccaccg gcgacctgac gatgcgcgac cacggtcgcg atccggtctg ggcgagcggt      1140
     gtcaccccgt cggacgtcgg ccagggcgcg gtgggggact gctacctcct ggccgcgctc      1200
     atcggtatcg cgcaggccga tccggggctg ctgcgccgca atctgcggga gaacccgaac      1260
     gggacggtca gcgtcaccgt ccaccttcct accggcgcgg tcccggtcac ggtcaccaga      1320
     agcctgcctg cccgggcggg ggccgggcag gagatcgccg cggacgcgga caacgccgcg      1380
     ggcgagccgg agctctgggc cgcgctctac gagaaggcct gtgcgcggat ggctggcagc      1440
     tacgcgcgtc ttgagggcgg tgaccccgcc accgcgatgg agtacctgac cggcacagcc      1500
     gcggtccgcc gctcgccgtc cgccgtgggt gtcgacgagc tcgccgccag gctggcagcc      1560
     ggtggggtgg tgaccgtcgt gacgcgttcg gacctgccgc cgggttgcgg gctggtgccc      1620
     aaccacgcct acgcggtgct gaaggcggac gcgcggacgg ggcaggccct cctccgtaac      1680
     ccgtgggatc aggccggcac cgacgaccgg ctggagtggc acgactggga cggtctgaag      1740
     ccggcgctgg cgggcgtcca gtgggcttcg accggccgcg gtccgccggc tcgatga         1797
//

If you have problems or comments...

PBIL Back to PBIL home page