(data stored in ACNUC7421 zone)

EMBL: CP000820.PE120

CP000820.PE120       Location/Qualifiers
FT   CDS_pept        146934..147740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO5810 transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09589"
FT                   /db_xref="GOA:A8LCF0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF0"
FT                   /protein_id="ABW09589.1"
FT                   /translation="MAGGRLVAEFRRRPRLCSQRFVLFVNAPIGLLVALLAPRVLTEAP
FT                   RRTGTFDLPGAVGVTAGVTVGVYGLTRTTTHGWSDALTLLCLIGGVALLGLFLLREAMC
FT                   REPLVPLWLFRNRDRGGANLIILAVAVAMFGVFYFLTLFVQGVLGYSPLFWLSTLSADS
FT                   SYPTLLLPATVLFGFGVGISFVPLTAVAVAGVDAADAASAAGSARPSPAAIIEASVAGY
FT                   ADALLVGAGMCLAAMLAGLFMITPAAGRLESAGAAEGASQPVPGHV"
     atggctggcg gcagactcgt ggccgaattc cgtcggcggc cccggttatg ttcccagcgc        60
     ttcgtcctgt tcgtgaacgc gccgatcggc ctgcttgtgg ccctgctggc gccgcgggtc       120
     ctgaccgagg caccccggcg gacgggaacg ttcgacctcc ccggcgcggt cggggtcacc       180
     gccggtgtga cggtcggcgt ctacggcctg accaggacga ccacccacgg atggtcggac       240
     gcgctgactc tgctctgcct gatcggcggg gtcgcgctcc tggggctctt cctcctccgg       300
     gaggcgatgt gccgcgagcc gctggttccg ctgtggctgt tccggaaccg ggatcgcggc       360
     ggtgccaatc tgatcattct cgccgtcgcc gtggcgatgt tcggcgtctt ctacttcctc       420
     accctgttcg tgcagggcgt gctcggctac agcccgctct tctggctgtc gaccctgtcg       480
     gcggactcgt cctaccccac gttgctgctg cccgcgacgg tgctgttcgg cttcggggtc       540
     gggatctcgt tcgtcccgct caccgccgtc gcggttgccg gcgtggacgc ggcggacgcg       600
     gccagcgccg ccgggtcggc caggccctcg cccgccgcga tcatcgaggc ctcggtcgcc       660
     gggtacgccg acgccctcct ggtcggggcg gggatgtgcc tggcagcgat gctcgccggg       720
     ctgttcatga tcacgccggc cgccggccgg ctggagtcgg ccggtgcagc cgagggcgca       780
     tcccagcccg ttcccggcca cgtctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page