(data stored in ACNUC7421 zone)

EMBL: CP000820.PE124

CP000820.PE124       Location/Qualifiers
FT   CDS_pept        complement(150756..151208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09593"
FT                   /db_xref="GOA:A8LCF4"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF4"
FT                   /protein_id="ABW09593.1"
FT                   /translation="MSTPPVDLSWSPPIWRCAAYAAGGAVLLVVAAVEDLAWRVASLDG
FT                   AGRLLVGLVGLGLVALAVSDAVSRPTLRLGPGGIDYVEGLRRRHLPWAAVIGARSGTLT
FT                   HGRRLVHLRTLEIETIDGPVLLSRRALGTDPERVAEAVEELRLRLG"
     atgagcacac ccccggtcga cctctcgtgg tccccgccga tctggcggtg cgcggcctac        60
     gccgcgggcg gcgcggtgct gcttgttgtg gccgccgtcg aggacctcgc ctggcgggtc       120
     gcctccctcg acggcgcggg acggctgctg gtcgggctgg tcgggctggg cctggtggca       180
     ctcgcggtca gcgacgcggt gtcccgaccg accctgcggc tcggccccgg cgggatcgac       240
     tacgtggagg gcctgcggcg gcggcacctg ccgtgggccg cggtgatcgg cgcgcggtca       300
     ggcaccctca cccacggacg gcgcctcgtt cacctacgaa ccctggagat cgagaccatc       360
     gacgggcccg tgctgctcag ccgccgcgca ctgggcaccg acccggagcg ggtggccgag       420
     gccgtcgagg aactccgcct ccgtctgggc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page