(data stored in ACNUC7421 zone)

EMBL: CP000820.PE128

CP000820.PE128       Location/Qualifiers
FT   CDS_pept        155425..157335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0130"
FT                   /product="glycoside hydrolase 15-related"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   fal:FRAAL6761 conserved hypothetical protein; putative
FT                   glycosyl hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09597"
FT                   /db_xref="GOA:A8LCF8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF8"
FT                   /protein_id="ABW09597.1"
FT                   /translation="MAHTPTRRGGGSPFPPIAEYGFLSDCETNCLVAPSGNVEWMCVPR
FT                   PDAPSVFGAVLDRSAGGFRFGPDRTFIPAGRRYLPGTNVLETTWQTPTGWLIVTDCLVV
FT                   GRWHRTHRRSKTHRRTPGDWDADHVLLRLARCEHGDVDLSLVCEPNFDYGRSPASWRYE
FT                   DEDYSTGIITHDFPAGDPAAGVALRLRTDLRLGFDGRRALARTTLREGDTAFVAMTWRA
FT                   EDPLLPGNYPQACAAVDSTTEFWRQWLSRGRFPDHPWRRHLQRSALALKGLTYAPTGAL
FT                   LAAATTSLPETPQGERNWDYRYSWIRDSTFALWGLYTLGLDYEANDFFSFIADVAEHAD
FT                   DIQVMYRVGGEPKIDEEILGHLSGYDGAVPVRVGNEAAKQRQHDVWGAVLDSVYLHTRS
FT                   RDYLSERLWPVLVRLVEAAAAHWRETDRGMWEVRGEPRHFTSSKMFCWVALDRGRRLAQ
FT                   MRGDLRTAGRWDDIADEIHADVLANGVDHRGVFTQYYGSTSLDASVLLMPLLGFLPSTD
FT                   DRVKATVLAIADELTVDGLVLRYRTDETDDGVEGEEGAFLICSFWLVSALVEIGELTRA
FT                   RQLCERLLSLASPLDLYAEEIDPADGRHLGNFPQAFTHLALINAVMYVIRAESGESFTR
FT                   S"
     gtggcgcaca caccgacgcg gcgtggcggg ggcagcccgt tcccgccgat cgccgagtac        60
     gggttcctct ccgactgcga gacgaactgc ctcgtggcgc ccagcggcaa cgtcgagtgg       120
     atgtgcgtgc cacgcccgga cgcgccgagc gtgttcggtg ccgtcctcga tcgctcggcc       180
     ggcgggttcc gcttcggacc ggaccggacc ttcattccgg ccggccggcg gtacctgccc       240
     ggcacgaacg tccttgagac gacctggcag acgcccacgg gctggctgat cgtcaccgac       300
     tgcctggtcg tgggccgctg gcaccggacg caccggcgct ccaagacgca ccggcgcacc       360
     ccgggcgact gggacgccga ccacgtgctg ctccggctgg cccgctgcga gcacggcgac       420
     gtcgacctca gcctcgtctg cgagcccaac ttcgactacg gccgcagccc ggcgtcctgg       480
     cggtacgagg atgaggacta ctcgaccggg atcatcaccc acgacttccc ggccggcgac       540
     ccggcagcgg gcgtcgcgct gcggctgcgc accgacctgc ggctcgggtt cgacggccgc       600
     cgcgcgctgg cccggacgac gttgcgggag ggcgacaccg cgttcgtggc gatgacctgg       660
     cgggccgagg acccgctgct gcccggtaac tatccgcagg cctgcgccgc cgtcgacagc       720
     accaccgagt tctggcggca gtggctttcg cgtgggcggt tccccgacca tccgtggcgc       780
     cggcacctgc agcgcagcgc actggcgctc aagggcctca cctacgcccc gaccggggcg       840
     ctgctcgccg ccgcgaccac ctcgctgccg gagacgccgc agggcgagcg caactgggac       900
     taccgctaca gctggatccg ggactccacg ttcgccctgt ggggcctgta caccctcggg       960
     ctcgactacg aggccaacga cttcttctcc ttcatcgcgg acgtcgccga gcacgccgac      1020
     gacatccagg tgatgtaccg ggtcggtggc gagccgaaga tcgacgagga gattctcggg      1080
     catctgtccg gctatgacgg cgccgtcccg gtgcgggtcg gtaacgaggc ggcgaagcag      1140
     cgccagcatg acgtttgggg ggccgttctc gactcggtct acctgcacac ccggtcgcgg      1200
     gactatctct cggagcggct gtggccggtg ctggtccggc tggtggaggc ggcggccgcg      1260
     cactggcggg agacggaccg cggcatgtgg gaggtccggg gcgagccgcg gcatttcacc      1320
     tcgtcgaaga tgttctgctg ggtcgcgctg gaccgggggc gccgcctcgc gcagatgcgc      1380
     ggtgacctgc gaaccgcggg ccgctgggac gacatcgccg acgagatcca cgccgacgtg      1440
     ctcgcgaacg gcgtcgacca ccgcggtgtc ttcacccagt actacggctc gacgtcgctg      1500
     gacgcctcgg tgctgctgat gccgctgctg ggtttcctgc cgtcgacgga cgaccgggtg      1560
     aaggcgaccg tgctcgccat cgccgacgag ctgacggtgg acggcctggt gctgcgctac      1620
     cggacggacg agaccgatga cggggtcgag ggcgaggagg gcgccttcct catctgctcg      1680
     ttctggctcg tctccgctct ggtggagatc ggtgagctca cccgggcccg gcagctgtgc      1740
     gagcggctgc tgagcctggc cagcccgctg gacctctacg ccgaggagat cgatccggcc      1800
     gacggccggc acctgggcaa cttcccgcag gccttcaccc acctggcgct gatcaacgcg      1860
     gtcatgtacg tgatccgggc cgagtccggg gagtccttca cccgctccta g               1911
//

If you have problems or comments...

PBIL Back to PBIL home page