(data stored in ACNUC7421 zone)

EMBL: CP000820.PE129

CP000820.PE129       Location/Qualifiers
FT   CDS_pept        complement(157556..157822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0131"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   sco:SCO3854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09598"
FT                   /db_xref="GOA:A8LCF9"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF9"
FT                   /protein_id="ABW09598.1"
FT                   /translation="MPESRRRKPKKTTVAAPQTSTRAPKRRPPSPPWFGGMILAFFLIG
FT                   IAYLLVYYFSNGGVLGMESLGGWNILIGFGFVVVGLAVSTQWR"
     gtgcccgaat cccgacgccg gaagccgaag aagaccacgg tggcggcccc gcagaccagc        60
     acgcgcgcac cgaagcgcag gccgccgtca ccgccatggt tcggcggcat gatcctggcg       120
     ttcttcctga tcggcatcgc ctacctgctc gtgtactact tctcgaacgg cggcgtgctg       180
     gggatggaga gcctcggcgg ctggaacatc ctgatcggct tcggttttgt cgtcgtgggc       240
     ctcgccgtgt ccacccagtg gcgctga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page