(data stored in ACNUC7421 zone)

EMBL: CP000820.PE13

CP000820.PE13        Location/Qualifiers
FT   CDS_pept        complement(19531..19959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0013"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: fal:FRAAL0026
FT                   putative organic hydroperoxide resistance protein
FT                   (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09482"
FT                   /db_xref="GOA:A8LB28"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB28"
FT                   /protein_id="ABW09482.1"
FT                   /translation="MAAPLYTATSTAWGGRDGRVVSNDNRIDLQLSMPKGLGGDDGPGT
FT                   NPEQLFATGYAACFHGALKAVARERKIDVTDSAVTVSVSISRTDEGLDLSTRIEAQIPG
FT                   VDPATGRELLDLAHAKCPYSRATRGNIAAEVTLVDGDS"
     atggccgcac cgctctacac cgccacgtcc accgcctggg gcggccgcga tggccgcgtg        60
     gtgtccaacg acaaccgcat cgacctgcag ctgtccatgc cgaaggggct gggcggggac       120
     gacgggcccg gcacgaaccc cgagcagctc ttcgccacgg gctacgccgc ctgcttccac       180
     ggcgcgctga aggccgtcgc ccgggaacgc aagatcgacg tgaccgactc ggcggtcacc       240
     gtgtcggtca gcatcagccg caccgacgag ggcctcgacc tgtccacccg catcgaggcg       300
     cagatcccgg gcgtcgaccc ggcgaccggc cgtgagctgc tcgacctcgc gcacgccaag       360
     tgcccgtact cgcgggccac ccggggcaac atcgccgcgg aggtgacgct ggtcgacggc       420
     gacagctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page