(data stored in ACNUC7421 zone)

EMBL: CP000820.PE130

CP000820.PE130       Location/Qualifiers
FT   CDS_pept        158037..158927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0132"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   fal:FRAAL6757 conserved hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09599"
FT                   /db_xref="GOA:A8LCG0"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG0"
FT                   /protein_id="ABW09599.1"
FT                   /translation="MPGGGPARKAGSTTDETDKTEGPAPTPAARRRATGWRIALVGLVV
FT                   ACAALLTAAAVRPSAGGRVGGAGVVSVAGLVAQDRRRVDAELDRLQTEREALAANPASS
FT                   AAPAAPPTPPAPAAGDPLDRRAALAAQVGLTAMRGPAVTVELDDAPRESRGRSLPPGVP
FT                   PPGPNDLVVHQQDVQAVVNALWAGGAEAMAIMDHRVTPRTAVRCVGNTLLLEGQVYSPP
FT                   FRISAIGDPDVLRAALDTDPGVLLYREYVDAYGLGYQVTSGPDVVLPAYAGSLLTGSGA
FT                   VARPASGIPSASGGQ"
     ttgcccggcg gtggcccggc acggaaggcc ggaagcacga cggacgagac ggacaagaca        60
     gaagggccgg cgcccacgcc ggcggcgcgg cggcgggcca cgggctggcg gatcgcgctg       120
     gtcggcctgg tcgttgcctg cgccgcgctg ctcaccgcgg cggccgtgcg gccatcggcg       180
     ggcgggcgcg tcgggggcgc cggggttgtc agcgtcgccg ggctggtcgc ccaggaccgc       240
     cgccgggtgg acgcggaact tgaccggctc cagaccgagc gcgaggcgct ggcggcgaac       300
     ccggcatcgt cggcggcccc ggccgcaccg cccacgccgc ccgcgccggc ggcgggtgat       360
     ccgctcgacc gtcgtgccgc gctcgcggcc caggtggggc tcaccgcgat gcgcgggccg       420
     gcggtcacgg tcgagctgga cgacgcgccg cgggagagcc ggggccggtc gctgcccccc       480
     ggcgtccccc cgcccggccc gaacgacctc gtcgtgcacc agcaggacgt ccaggcggtc       540
     gtgaacgcgc tgtgggccgg tggtgccgag gccatggcca tcatggatca ccgggtgacc       600
     ccgcggacgg ccgtgcggtg cgtggggaac acgctgctgc tggaggggca ggtgtactca       660
     cccccgttcc ggatcagcgc gatcggtgac cccgacgtgc tgcgggccgc gctggacacc       720
     gaccccggtg tgctgctcta ccgggagtac gtcgatgcct acggcctggg gtaccaggtg       780
     acgtccggcc cggacgtcgt cctgcccgcg tacgccggga gcctgctgac ggggtccggg       840
     gcggtggccc ggcccgcgtc cggtatcccg tcggcgtccg gcggccagtg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page