(data stored in ACNUC7421 zone)

EMBL: CP000820.PE132

CP000820.PE132       Location/Qualifiers
FT   CDS_pept        complement(159777..161879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0134"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: fal:FRAAL6755 putative
FT                   serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09601"
FT                   /db_xref="GOA:A8LCG2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG2"
FT                   /protein_id="ABW09601.1"
FT                   /translation="MTDVTDRYEAQPRLVGERYELGGCIGYGGMAEVYRGRDIRLGREV
FT                   AVKTLRADLARDPTFLARFRREAQSSASLNHPAIVSVYDTGEDVINGTQLPYIVMEFIA
FT                   GQTLRDVLQAQGALDERHAMQVTAEVCAALDYSHRMGIIHRDIKPANVMLASDGSAKVM
FT                   DFGIARATTATTSNMTATSAVIGTAQYLSPEQARGARVDTRSDVYSTGVLLYELLTGEP
FT                   PFRGDNPVAVAYQHVREIPPPPSSHDSRISPEADAVVLKAMEKDPDDRYATAGEMRDDL
FT                   ERALSGHRVHAMMMGAGDETMLGGAGAGTAGTALLGRSGGGYDDRYEGGGYQGRYDDGY
FT                   DEPGGYDDGYGEQTRVRGEPYDRYDQTGPVDRYGNAGPPGHRPGDDRDREGSSTWKFVL
FT                   AGLGAVVVFVVVALLASSLLGGGGGGDDTAAAQVTIPSGLKGQPYDAVVGRLQSEGFTG
FT                   HFDKQTQESTDVAPNSVLEISPGEGQTIAADGTISITVAIAPGQVTVPQGLAGMTQQAA
FT                   TDALTALGLQASPMQYYEAANHGVGKVEKTEPEAGRPVDSGSSVTIWVVSSTVNVPNVK
FT                   GKNASAAISELQRYGLTAVQETVVDNASQPGTVSDQSPAGGAVNRGSSVKIFIAAQNQQ
FT                   PATPTATATTPPPTDTPPVIIDPTTPPATTPPATATQPAGGGTPTNGQQPGAAGPLRGA
FT                   LNRPSS"
     gtgacggatg taactgacag gtacgaagct caaccgagac tggtcggtga gcgctacgag        60
     ctcggtggct gcatcggcta cggcggcatg gccgaggtct accggggccg cgacatccgg       120
     ctgggccgcg aggtcgcggt caagacgctg cgcgccgacc tcgcccgcga cccgaccttc       180
     ctggcccggt tccgccggga ggcgcagtcc tcggcctcgc tgaaccatcc cgcgatcgtc       240
     tcggtgtacg acaccggcga ggacgtcatc aacgggaccc agctcccgta catcgtcatg       300
     gagttcatcg cgggccagac cctgcgggac gtcctgcagg cgcagggcgc cctcgacgag       360
     cggcacgcca tgcaggtcac cgcggaggtc tgcgcggcgc tggactacag ccaccggatg       420
     ggcatcatcc accgcgacat caagcccgcg aacgtgatgc tggcctccga cggctcggcc       480
     aaggtgatgg acttcggcat cgcccgcgcc accaccgcca cgacgtcgaa catgaccgcg       540
     acgtccgccg tgatcggcac ggcgcagtat ctctcccccg agcaggcccg gggcgcgcgg       600
     gtggacaccc gcagcgacgt ctactccacc ggcgtgctgc tctacgagct gctgaccggc       660
     gagccgccgt tccgcggcga caacccggtc gccgtcgcct accagcacgt gcgggagatc       720
     cccccgccgc cgtcgagcca cgactcccgg atctcccccg aggccgacgc ggtcgtcctg       780
     aaggcgatgg agaaggaccc cgacgaccgg tacgccaccg ccggcgagat gcgcgacgac       840
     ctcgagcgcg cgctgagcgg gcaccgcgtg cacgccatga tgatgggcgc gggcgacgag       900
     acgatgctcg gcggtgcggg agcgggcacg gccggcacgg cgctgctcgg ccgctccggc       960
     ggcggctacg acgaccggta cgagggcggc ggctaccagg gccgctacga cgacggctac      1020
     gacgagccgg gcgggtacga cgacggctac ggcgagcaga cccgcgtgcg cggcgagccc      1080
     tacgaccgct acgaccagac cgggcccgtc gaccgctacg gcaacgccgg cccccccggt      1140
     caccgccccg gcgacgaccg ggaccgtgag ggctcgtcga cctggaagtt cgtcctcgcc      1200
     gggctcggcg cggtcgtcgt cttcgtggtg gtcgcgctgc tcgcctcctc gctactcggc      1260
     ggcgggggcg gcggtgacga cacggccgcg gcacaggtca ccatcccctc cgggctgaag      1320
     ggccagccct acgacgccgt cgtgggccgg ttgcagagcg agggcttcac cgggcacttc      1380
     gacaagcaga cccaggagag cacggacgtc gccccgaact cggtgctgga gatctccccg      1440
     ggcgagggcc agaccatcgc ggcggacggc acgatctcca tcacggtggc gatcgcgccg      1500
     ggccaggtga ccgtcccgca gggcctcgcc ggcatgaccc agcaggcggc gacggacgcg      1560
     ctgaccgccc tcgggctgca ggcgtcgccg atgcagtact acgaggcggc gaaccacggt      1620
     gtgggcaagg tcgagaagac cgagcccgag gctgggcgcc cggtcgactc cggtagctcg      1680
     gtcacgatct gggtggtcag ctcgacggtc aacgtgccca acgtgaaggg caagaacgcg      1740
     tcggcggcca tctccgagct gcaacggtac ggcctcaccg ccgtccagga gaccgtcgtg      1800
     gacaacgcca gccagccggg caccgtctcc gaccagagcc cggccggcgg cgccgtcaac      1860
     cgcggctcct cggtgaagat cttcatcgcg gcgcagaacc agcagccggc caccccgacg      1920
     gcgaccgcca ccacgccacc gccgaccgac actccaccgg tgatcatcga tccgacgacc      1980
     ccgccggcga caaccccgcc ggcgaccgct acgcagccgg ccggtggcgg gacgccgacg      2040
     aatggccagc agcccggtgc tgccgggccc ctccggggag ctctgaaccg accgagctcc      2100
     tga                                                                    2103
//

If you have problems or comments...

PBIL Back to PBIL home page