(data stored in ACNUC7421 zone)

EMBL: CP000820.PE133

CP000820.PE133       Location/Qualifiers
FT   CDS_pept        complement(161876..163555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0135"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   fal:FRAAL6754 serine/threonine-protein kinase PknA (partial
FT                   match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09602"
FT                   /db_xref="GOA:A8LCG3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG3"
FT                   /protein_id="ABW09602.1"
FT                   /translation="MSTSANSPSPSQPFAGAASPNTVLDNRYRLDGRIATGGMGEVWRG
FT                   LDQTLGRPVAVKLLRPEYASDESFLVRFRGEARHAARLSHPGVASVYDYGEVSTADDYP
FT                   TAYLVMELVEGEPLSALLHREKRLSPDRMLDILGQSADALQAAHALGVVHRDVKPGNLL
FT                   LRTDGAVKVTDFGIARAVDAAPLTATGIMMGTAYYVSPEQASGRPVTPASDVYSLGVVA
FT                   YECLAGRRPFDDRNPIVVVMAHQQDTPPPLPSDIPYQVRALVESAMSKDASRRPSSAGA
FT                   FARSAASIRRSLWNSDAGRWSGTPGAADATARHPAPPAPPHLGPVPPRAPTAPRTPSWN
FT                   RSGGASWTQQPPPADPTAAAPGMPATALQPSPGQGGSGPGAGRGGGPGRLYGSGDYPPD
FT                   PRNPSDYRNPSDYRNDYPPGGEHGPGWHGGRDDGGHRDGSGHRDGGPGDPANTLYQPSP
FT                   SWSDPPGDGPGGRVAHRRPGAAAQRRRLPLPVLIALLILTVLVVAVITRTVAEAGGSKD
FT                   GAAATSNVLYLTPAEGEIVGPAGEAAGTVVAGAAEPTTGDNL"
     atgagcacat ccgccaacag tccgtcaccg tcgcagccgt tcgccggcgc cgcctccccc        60
     aacaccgtgc tcgacaaccg ctaccgcctg gacggccgca tcgcgaccgg tgggatgggt       120
     gaggtctggc gtggcctcga ccagacgctc ggccgtcccg tcgcggtgaa gctgctgcgc       180
     cccgagtacg ccagtgacga gtccttcctg gtgcgcttcc ggggcgaggc ccggcacgcg       240
     gcgcggctgt cccaccccgg tgtggcctcc gtgtacgact acggcgaggt ctccaccgcc       300
     gacgactacc cgaccgccta cctggtgatg gagctggtgg agggcgagcc gctctccgcg       360
     ctgctgcacc gggagaagcg gctgagcccc gaccggatgc tcgacatcct cggccagtcc       420
     gccgacgcgc tgcaggcggc gcacgccctc ggcgtcgtcc accgcgacgt caaacccggc       480
     aacctgctgc tccggaccga cggagcggtg aaggtgaccg acttcggcat cgcgcgcgcg       540
     gtcgacgcgg ccccgctgac cgcgaccggg atcatgatgg ggacggcgta ctacgtctcc       600
     ccggagcagg cgtccgggcg cccggttacc cccgcgagcg acgtgtactc gctcggcgtg       660
     gtcgcctacg agtgcctggc cgggcggcgg ccgttcgacg accgcaaccc catcgtcgtc       720
     gtcatggccc accagcagga cacgccgccg ccgcttccct cggacatccc gtaccaggtc       780
     agggccctgg tcgagtcggc gatgtcgaag gacgcctcgc gccggccgag ctcggcgggc       840
     gcgttcgccc gctcggcggc cagcatccgg cgcagcctgt ggaactccga cgccgggcgg       900
     tggagcggca ccccgggtgc cgcggacgcc accgcgcgcc atcccgcgcc acccgcgcca       960
     ccgcacctgg ggccggtgcc cccgcgggcg ccgaccgccc cacgcacgcc gtcgtggaac      1020
     cgctccggcg gcgcgtcctg gacccagcaa ccgccgccgg cggacccgac cgccgcggca      1080
     cccggcatgc cggccaccgc cctgcagccc tccccggggc agggcggctc cgggccgggc      1140
     gccgggcgcg gcggcggccc gggacggctc tacgggtcgg gcgactaccc gcccgacccc      1200
     cgcaacccgt ccgactaccg caatccgtcc gactaccgca acgactatcc gcccggcggc      1260
     gagcacggcc cggggtggca cggcggtcgg gacgacggcg ggcaccggga cggcagcggg      1320
     catcgggacg gcgggcccgg cgatccggcc aacacgctct accagccgtc gccgtcctgg      1380
     tcggacccgc cgggcgacgg gccgggcggc cgggtcgcgc accgccggcc gggcgccgcg      1440
     gcccagcgcc ggcggctccc gctgccggta ctcatcgcgc tgctgatcct caccgtgttg      1500
     gtggtagcag tgatcactcg caccgtcgcc gaggcgggcg gttccaagga tggggcggcc      1560
     gccacgtcga atgtgctata tctcacaccc gcggagggtg agatcgtcgg cccggccggc      1620
     gaggcggctg gcacggtggt ggccggcgct gcagagccga cgacgggtga caacctgtga      1680
//

If you have problems or comments...

PBIL Back to PBIL home page