(data stored in ACNUC7421 zone)

EMBL: CP000820.PE135

CP000820.PE135       Location/Qualifiers
FT   CDS_pept        complement(164997..166478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0137"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: fal:FRAAL6752
FT                   putative cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09604"
FT                   /db_xref="GOA:A8LCG5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG5"
FT                   /protein_id="ABW09604.1"
FT                   /translation="MTLPPLRRPRSADLTATFAGFPLPSGLELPPYRRRELFLLGYAGV
FT                   LATGALAALMLAHDGTIGFQVFTYGLGFFSLWALGHLAVRRFAPAADPVLLPVVAALNG
FT                   IGLVMIYRLDLAKADSARRAGNPIPTGAAQTQLVWTLLAIVVFVLVLAVVRDHRALSRY
FT                   AYTLGLAGLVFLVLPIAPGIGATINGARLWLQVGPFSFQPSEVSKIALMIFFAAYLENK
FT                   RDVLSLASRSFLGMKIPRARDLGPVLVAWLASLGVLVVQKDLGSSLLFFGMFLVILYVA
FT                   TQRASWVAIGLCLFMLGAVVAHSLFGHVQVRVDGWLHAFDGNNPSNTSYQLVQGLYGFA
FT                   AGGLTGTGIGQGSPQRVPFANTDFVMASLGEEFGLTGVMAILLLYALVAARGIRAALGA
FT                   KDPFGKLLATGLSATVALQVFVQVGGVMRLIPLTGLTLPFVSYGGSSIVANAAIIALLL
FT                   RISDAARRLEEPVPDAPLFDPNAVAESPTQVVKTT"
     atgacccttc ccccgctgcg ccggccgagg tcggcggacc tgacggcgac gttcgccggg        60
     ttcccgctgc cgagcgggct cgagctgccg ccgtaccgcc gccgagagct gttcctgctc       120
     ggttacgccg gcgtgctggc gacgggcgcg ttggccgcgc tgatgctggc ccacgacggg       180
     acgatcggct tccaggtctt cacctacggt ctcggcttct tctcgctgtg ggcgctgggg       240
     cacctggccg tccgccggtt cgcgccggcg gccgacccgg tgctgctccc ggtggtggcg       300
     gcgctcaacg ggatcggcct ggtcatgatc taccggctgg acctggcgaa ggccgacagc       360
     gcccggcgcg ccggcaaccc gatcccgacc ggcgccgcgc agacccagct cgtctggacc       420
     ctgctggcga tcgtcgtgtt cgtactggtt ctggcggtcg tgcgcgatca tcgggcgctg       480
     tcccgctacg cctacacgct gggcctggca ggcctggtct tcctggtcct gccgatcgcg       540
     cccggcatcg gggccaccat caacggggcc cggctgtggc tgcaggtcgg gccgttctcg       600
     ttccagccca gcgaggtctc gaagatcgcc ctgatgatct tcttcgccgc ctacctggag       660
     aacaagcggg acgtcctctc cctggcgtcg cggtccttcc tcggcatgaa gatcccgcgg       720
     gcacgtgacc tcgggccggt gctcgtggcg tggctggcca gcctgggcgt cctggtggtg       780
     cagaaggacc tcggctcgtc cctgctgttc ttcgggatgt tcctggtcat cctgtacgtg       840
     gcgacccagc gcgcgtcgtg ggtcgcgatc ggcctgtgcc tgttcatgct cggcgcggtg       900
     gtggcgcaca gcctgttcgg ccacgtccag gtccgcgtcg acggctggct gcacgccttc       960
     gacggcaaca acccgtcgaa cacgtcgtat cagctcgttc agggcctcta cggattcgcc      1020
     gccggaggcc tgaccggcac ggggatcggc cagggcagcc cgcagcgggt ccccttcgcc      1080
     aacaccgact tcgtcatggc cagcctgggc gaggagttcg ggctgaccgg cgtgatggcg      1140
     atcctgctgc tgtacgcgct cgtggcggcc cgcggcatcc gggcggcgct cggagccaag      1200
     gacccgttcg gcaagctgct ggcgaccggc ctctccgcga ccgtcgcgct gcaggtgttc      1260
     gtgcaggtcg gaggcgtcat gcggctcatc ccgctgaccg gcctgacact tccgttcgtc      1320
     tcctacggcg gttcgtccat cgtcgcgaac gccgccatca tcgcgctgct gctgcggatc      1380
     agcgacgccg cgcggcgcct ggaggagccc gtcccggacg ccccgctgtt cgacccgaac      1440
     gccgtggcgg agagccccac ccaggtggtg aagaccacgt ga                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page