(data stored in ACNUC7421 zone)

EMBL: CP000820.PE14

CP000820.PE14        Location/Qualifiers
FT   CDS_pept        20169..20873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0014"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL0027
FT                   putative transcriptional regulator (HTH-type)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09483"
FT                   /db_xref="GOA:A8LB29"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB29"
FT                   /protein_id="ABW09483.1"
FT                   /translation="MPPDDPAAECVRPRRGRPRDATIDDRVLRAAVDELAGRGVGGFSV
FT                   NSVAARAGVAKRGIYTRWATRDDLVLAALGTLAAGLVPPRTGSLREDLLRLAPLVDAVF
FT                   TEPRMSILARCLAELPRYPGLYEAFRRESVDRCAAAVQDAFHDARRRGEIRSDLDTDLA
FT                   AAAFLGALLTRQAFGRQAFGRPRAGPGGPGGPGGEPGEPPEPPGAVTAYHRRLVEFSLA
FT                   AARGAGQAFGPA"
     atgccccccg atgacccggc cgcggagtgt gtgcggccac gtcggggccg tcctcgcgac        60
     gcgacgatcg acgaccgtgt gctgcgggcc gccgtcgacg aactggctgg tcgcggcgtc       120
     ggcgggttca gcgtcaacag cgtcgccgcc cgcgcgggcg tggcgaagcg gggcatctac       180
     acccggtggg cgaccaggga cgatctcgtc ctcgccgcac tgggcacgct ggccgccggc       240
     ctcgtgccgc cgcgcaccgg atccctgcgc gaggatctcc tacgactggc acctctggtg       300
     gacgccgtct tcaccgagcc gcggatgtcg atcctcgccc gatgcctggc cgagctgccc       360
     cggtaccccg ggctgtacga ggcgttccgg cgggagtcgg tcgaccgctg cgcggccgcc       420
     gtgcaggacg cgttccacga cgcgcggcgg cgcggagaga tccgctccga cctcgacacc       480
     gacctggccg ccgccgcgtt cctcggcgcc ctgctgaccc gtcaggcctt cgggcgccag       540
     gcgttcgggc ggccgcgcgc cggcccgggc ggcccgggcg gcccgggcgg cgagccgggc       600
     gagccgcccg agccacccgg tgcggtcacg gcctaccacc gccggctcgt cgagttctcc       660
     ctcgccgcgg cgaggggcgc cgggcaggcc tttggccccg cgtag                       705
//

If you have problems or comments...

PBIL Back to PBIL home page