(data stored in ACNUC7421 zone)

EMBL: CP000820.PE141

CP000820.PE141       Location/Qualifiers
FT   CDS_pept        172402..173202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0143"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL6746
FT                   putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09610"
FT                   /db_xref="GOA:A8LCH1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH1"
FT                   /protein_id="ABW09610.1"
FT                   /translation="MPGPVSWAPGNGRMGRPRAEPVFSRRAGAETAPARHLSSIPVPPG
FT                   PARARPVSRPPGSPRPLRCDAERNRERVLVAARELFVEQGLDVGVDEIVKRAGVGMGTL
FT                   YRRFPNKDALIEAILGTVVDHLRSIAEDVLATEPPTVALRSFFVRSITTEVCQWAFLSS
FT                   RLWRGRTNELLFADVVPLIGEMFTQAQQAGAVRPDVVLSDLIVLVRSMRVVLDLTDGFA
FT                   PEVWRRHLDLLLDGLRPCSGNAVLDVGPMPFDALAISAAARPLV"
     gtgcccggtc ccgtcagctg ggctccggga aacggccgga tgggccggcc gcgtgccgag        60
     ccggtgttct cgcgccgggc cggtgcggag accgcgcccg cccggcacct gagctcgatc       120
     ccggtgccgc ccgggccggc gcgggcgagg ccggtctccc ggccgcccgg ctcgccgcgg       180
     ccgctgcgct gcgacgccga gcgcaaccgt gagcgggtgc tcgtcgccgc ccgtgagctg       240
     ttcgtcgagc agggcctcga cgtcggcgtc gacgagatcg tgaagcgggc cggggtcggg       300
     atgggcacgc tgtaccggcg gttcccgaac aaggacgcgc tcatcgaggc gatcctcggc       360
     acggtcgtcg atcatctgcg ctcgatcgcc gaggacgtgc tggccaccga gccaccgacg       420
     gtggcgctgc ggtcgttctt cgtccggtcg atcacgaccg aggtctgcca gtgggccttc       480
     ctgtcgagcc ggctttggcg cgggcggacc aacgagctgc tgttcgccga tgtggtcccg       540
     ctgatcggag agatgttcac ccaggcgcag caggccgggg cggtgcggcc ggacgtcgtg       600
     ctctccgacc tgatcgtgct ggtccggtcg atgcgggtcg tgctggacct gaccgacggt       660
     ttcgcacccg aggtctggcg gcgccacctc gacctcctgc ttgacggcct gcggccctgc       720
     tccggcaacg ccgtcctcga cgtcgggccg atgccgttcg acgcgctcgc gatctcggcg       780
     gcggccaggc cgctcgtctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page