(data stored in ACNUC7421 zone)

EMBL: CP000820.PE142

CP000820.PE142       Location/Qualifiers
FT   CDS_pept        complement(173237..175087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0144"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   fal:FRAAL6745 putative serine-threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09611"
FT                   /db_xref="GOA:A8LCH2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH2"
FT                   /protein_id="ABW09611.1"
FT                   /translation="MDHNGERVAPAARGQPGGMAPPGEVLHPHEPRAIGPYRLLRRLGA
FT                   GGMGTVYLAESAGRRVAVKVVRPDLAADEEFRRRFRQEVDAARRVAPFCTAEVLDADPD
FT                   AAAPYLVTEFIDGVRLDHAVENGPISGSTLTGLAVGVATALTAIHGSGLVHRDLKPSNV
FT                   LLSMSGPRVIDFGIAQALEGAKAKPTAWGFGSAGWMAPEQVNGQAIGPEADVFTWGILV
FT                   AYAGTGHHPFGTGTDLELSTRIVGSRPALDGLPHDLKALVAAALAKNPDDRPNARDLLL
FT                   SLISLPPTRSGDGRDDGTGRPSASAVGQAEELLNLTRGTTLPGLAPTRVAPGTSGERAP
FT                   ASHGGPPGHGGGAGPSGVAVPAPAGAPAFSGAPGAARGPAPGGGPAGFGPSGFRPAGAG
FT                   AAPHPPTHGPNPPVQGPRPPGQGPYPPVPSGTSQPRSTWHRVLLFGAAALAVVLAAWLI
FT                   SSVAGGSDDPGAVSGAGDRPAASQQPTTPRSGGLNTPVRDDQLEFTASKISCGADHVGD
FT                   GFLARRPSGQFCLVDMKITNVGTAERVLSNSNQYLHTSDGGRHAADFLARYWINDGIWD
FT                   TISPGATVTGTFVFDIPVDAEAEELELHERPESPGVTIQP"
     gtggatcaca acggggaacg cgtcgctccg gcggcgcgcg ggcagccggg tggcatggca        60
     ccacccggtg aggtcctgca cccgcacgaa ccccgggcga tcggcccgta ccgcctgctg       120
     cgccgcctgg gcgcgggcgg gatgggcacg gtgtacctcg ccgagtccgc cggccgccgg       180
     gtcgcggtga aggtcgtccg gccggacctg gccgccgacg aggaattccg gcggcggttc       240
     cggcaggagg tcgacgccgc ccgccgggtc gcgccgttct gcaccgccga ggtgctggac       300
     gccgaccccg acgccgccgc cccctacctg gtgaccgagt tcatcgacgg cgtccggctc       360
     gaccacgcgg tggagaacgg cccgatcagc ggctccacgc tgaccgggct cgccgtcggc       420
     gtggccaccg cgctgaccgc gatccacggc tccggtctcg tccaccgtga tctcaagccg       480
     agcaacgtgc tgctgtcgat gtccggcccc cgggtgatcg acttcggcat cgcgcaggcg       540
     ctcgagggcg ccaaggcgaa acccaccgcg tggggcttcg ggtccgccgg ctggatggcc       600
     cccgagcagg tgaacggcca ggccatcggc ccggaggccg acgtgttcac ctggggcatc       660
     ctggtcgcct acgcgggcac cggccaccac ccgttcggca ccgggacgga cctggagctc       720
     agcacccgca tcgtcggctc ccgcccggcc ctggacggcc tgccgcacga tctgaaggcg       780
     ctggtcgcgg ccgccctcgc caagaacccc gacgaccgcc cgaacgcccg cgacctgctg       840
     ctgagcctga tctcgctgcc gcccacccga tccggcgacg gccgggacga cggcaccggg       900
     cggccgagcg ccagcgccgt cggccaggcc gaggaactgc tgaacctcac caggggcacg       960
     accctgcccg gcctcgcgcc gacccgggtc gccccgggga cgtccggtga gcgggccccg      1020
     gccagccacg gcggcccccc aggtcacggt ggcggggcgg ggccgtccgg tgtcgctgtt      1080
     ccggcgccgg cgggcgcgcc ggccttctcc ggggcccccg gagcggcacg cgggccggct      1140
     cccggcggcg gccccgcggg attcgggccc tccggcttcc gccccgccgg tgctggcgcg      1200
     gcaccgcacc cacccacgca cgggccaaac ccgccggtgc aggggccgcg cccgcccggt      1260
     cagggcccgt acccgcccgt cccctctggg accagccagc ctcgctccac gtggcaccgc      1320
     gtgctcctgt tcggcgctgc cgcgctcgca gtcgtcctgg ccgcctggct gatcagctcg      1380
     gtcgccggcg gctcggacga tccgggagca gtctcgggag ccggcgaccg gcccgcggcg      1440
     tcccagcagc cgacgactcc gcgcagcggg ggcctgaaca cacccgtccg cgacgaccag      1500
     ctcgagttca ccgcgagcaa gatcagctgt ggcgccgacc acgtcggcga cgggttcctg      1560
     gcccgccgcc cgagcggcca gttctgcctg gtggacatga agatcaccaa tgtgggaacg      1620
     gccgagcgtg ttctgagcaa ctccaaccag tacctgcaca cctcggacgg cggccgccat      1680
     gccgccgact tcctggcccg ctactggatc aacgacggga tctgggacac gatctcgccc      1740
     ggcgccacgg tcacgggcac cttcgtcttc gacatccccg tggacgcgga ggccgaggag      1800
     ctcgagctgc acgagcggcc ggaaagcccg ggcgtcacga tccagccgta a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page