(data stored in ACNUC7421 zone)

EMBL: CP000820.PE143

CP000820.PE143       Location/Qualifiers
FT   CDS_pept        175224..175487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6744 hypothetical protein; putative
FT                   zinc beta-ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09612"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH3"
FT                   /protein_id="ABW09612.1"
FT                   /translation="MSSVSESSIPERAALRCTPDQSASRHPRTGAPLMTETAGPWLACP
FT                   WCGGQVPLAHLVPSDEEPGAVVAVCAGCGRRVTIIPPDDPRA"
     gtgtcgtcgg tgtcagagtc gtcgatacca gagcgggcgg cgctgcggtg caccccggac        60
     cagtccgcat cgcgacaccc ccggacggga gcaccgctga tgaccgagac cgccgggccg       120
     tggctggcct gcccctggtg cggtgggcag gtgccgctgg cgcacctggt gccctcggac       180
     gaggagcccg gcgccgtggt cgcggtctgc gcgggctgcg gacgccgggt gacgatcatc       240
     ccgccggacg acccccgggc ctga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page