(data stored in ACNUC7421 zone)

EMBL: CP000820.PE146

CP000820.PE146       Location/Qualifiers
FT   CDS_pept        178026..178289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0148"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: fal:FRAAL6738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09615"
FT                   /db_xref="GOA:A8LCH6"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH6"
FT                   /protein_id="ABW09615.1"
FT                   /translation="MTRVVVDVMLKPEILDPQGQAVLTALPRLGVAGISGVRQGKRFEL
FT                   DLDGEADAEALARIEHLASTLLANPVIEDYVVRVEPARVEAD"
     gtgaccaggg ttgtggtgga tgtgatgctc aagccggaga tcctcgaccc gcagggccag        60
     gcggtgctca cggcgctgcc gcgcctcggc gtggccggga tcagcggtgt tcgccagggc       120
     aagcgtttcg agctggacct ggacggcgag gccgacgccg aggcgctggc gcgcatcgag       180
     cacctcgcgt cgacgctgct ggcgaacccg gtgatcgagg actatgtcgt ccgggtggaa       240
     ccagcgcggg tggaagccga ctag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page