(data stored in ACNUC7421 zone)

EMBL: CP000820.PE147

CP000820.PE147       Location/Qualifiers
FT   CDS_pept        complement(178340..178690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0149"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: fal:FRAAL6737
FT                   putative metallo-beta-lactamase; rhodanese-like domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09616"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH7"
FT                   /protein_id="ABW09616.1"
FT                   /translation="MSPQQIPTVNVTELPVHLPAEGGPLLVDVREPDEWAAGHIDGAVH
FT                   IPMGDFLARISEVPREREIVVVCRSGSRSAAVTAHLAREGWQARNLVDGMIGWQAAGRP
FT                   MISETPLAPTVL"
     gtgagtcccc agcagatacc gaccgtgaac gtgacggagc ttcccgtcca cctgcccgcc        60
     gagggtggcc cgctgctcgt cgacgtacgc gagcccgacg agtgggccgc cggtcacatc       120
     gacggcgcgg tccacatccc gatgggcgac ttcctggccc gcatcagcga ggtcccccgg       180
     gagcgggaga tcgtcgtggt gtgccgctcc ggcagccggt cggccgccgt caccgcgcac       240
     ctggcccgtg agggctggca ggcccgcaac ctcgtggacg ggatgatcgg ctggcaggcc       300
     gccggccgcc ccatgatcag cgagaccccg ctcgccccca ccgtgctctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page