(data stored in ACNUC7421 zone)

EMBL: CP000820.PE15

CP000820.PE15        Location/Qualifiers
FT   CDS_pept        complement(20881..21498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0015"
FT                   /product="Endopeptidase Clp"
FT                   /EC_number="3.4.21.92"
FT                   /note="PFAM: peptidase S14 ClpP; KEGG: fal:FRAAL4270
FT                   proteolytic subunit of ClpA-ClpP ATP-dependent serine
FT                   protease (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09484"
FT                   /db_xref="GOA:A8LB30"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB30"
FT                   /protein_id="ABW09484.1"
FT                   /translation="MPGYLLPVDVAAVRRPTGRGLAGGGLVEGLKAGFVGAAVDDALAN
FT                   RVCAQLLLLAQASRRQDISLYINSPGGSVDAGMAIYDTMQFIENDVATYALGLAASMGQ
FT                   FLLTAGTAGKRFALPNSRIMMHQPHGGVGGTASDIAIQAEQALHTRRRMQELIAEHSGH
FT                   SVAEIAADSDRDRWFTAAAAKEYGLVDAVVEHVRRVPAGFTR"
     gtgcccgggt acctgctccc ggtcgacgtc gccgcggtcc gccggcccac ggggcgcggt        60
     ctcgccggag gtggcctcgt cgagggcctc aaggcgggat tcgtcggcgc cgccgtcgac       120
     gacgccctcg cgaaccgggt gtgcgcgcag ctcctgctgc tcgcccaggc cagcaggcgc       180
     caggacatct cgctgtacat caactcgccg ggcggctcgg tcgacgcggg aatggcgatc       240
     tacgacacga tgcagttcat cgagaacgac gtcgcgacct acgcgctcgg gctggcggcc       300
     tcgatgggcc agttcctgct caccgcgggc accgccggca agcggttcgc gctgccgaac       360
     tcgcggatca tgatgcacca gccacacggc ggcgtcggcg gcacggcgtc cgacatcgcc       420
     atccaggccg agcaggcgct gcacacccgc cgccggatgc aggagctgat cgccgagcac       480
     agcggtcact ccgtggcgga gatcgccgcc gactcggacc gcgaccgctg gttcaccgcg       540
     gcggcggcga aggagtacgg gctcgtcgat gccgtcgtgg agcacgtccg gcgcgtgccc       600
     gccggcttca cccgctga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page