(data stored in ACNUC7421 zone)

EMBL: CP000820.PE152

CP000820.PE152       Location/Qualifiers
FT   CDS_pept        182932..184167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09621"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI2"
FT                   /protein_id="ABW09621.1"
FT                   /translation="MEALEVRSESAGARGSRGSSDGAGVPPAGTATDHSEATAPSPADE
FT                   KPRRPVRRSSRRTRAAAAEPTPPTPPDASASATDALGDPPAGGPADASVGVPAGAVSGH
FT                   ESAVPGTSEPETPEPAARARIARTGRLLREPVLDAVCAGAVDLARAAAEEEAGSPAEVG
FT                   RHLGVEAEAERLVLHRFECLSRAYVGWTWTVVVARASRIRKATVNDVILTPGEGAVLAP
FT                   AWVPWSERLRPGDVGVGDLLPTAVDDPRLALRASDAEEIDDPEAWMGLGIGRPRMLSTF
FT                   GREEAAERWYGGDSGPDASIAKVAPAACLTCGFHVRLVGALGRLFGVCANELAPDDGRV
FT                   TAVDHGCGAHSEALVAPSARPEPVPFDEDPSDLTPTDIELVGVATHSPGSVPDQPPGTA
FT                   DADAGPEPYGHS"
     gtggaagcac tagaagttcg ttccgagtcg gctggggccc gtgggtcccg gggttcgtcg        60
     gatggtgccg gcgttccccc cgctggcact gcgacggatc acagtgaggc cacggcgccg       120
     tcccccgcgg acgagaagcc acgccggccc gtgcgccggt cgtcgcgccg cacgcgggcg       180
     gcagcggccg agcccacccc cccgacgcca cctgacgcgt cagcctccgc caccgacgca       240
     ttgggtgacc cgcccgccgg tgggccggct gatgcgtccg tcggcgttcc ggctggtgcg       300
     gtgtcggggc acgaaagtgc ggtgcccggg acatccgagc ccgaaacccc cgagccggcg       360
     gcgcgggcgc ggatcgcacg gacgggacgt ctgctgcggg agcccgtcct cgacgcggtg       420
     tgcgccggcg cggtggacct cgcccgtgcc gcggccgagg aggaggccgg ttcgcccgca       480
     gaggtcggca ggcacctcgg tgtcgaggcc gaggcggagc ggctcgtcct gcaccggttc       540
     gagtgcctct cccgcgccta cgtcggctgg acctggaccg tcgtcgtcgc gcgtgcgtcg       600
     cgcatccgga aggcgaccgt caacgacgtc atactgacgc cgggcgaggg cgcggtgctc       660
     gccccagcct gggtgccctg gtccgagcgc ctgcggccgg gtgacgtcgg cgtgggcgac       720
     ctgctcccga cggccgtgga cgacccccgg ctggcgctgc gggcgagtga cgcggaggag       780
     atcgacgacc ccgaggcctg gatggggctc gggatcggcc gcccccggat gttgtcgacc       840
     ttcggccggg aggaagccgc cgagcgctgg tacggcggtg actccgggcc ggacgcgtcc       900
     atcgccaagg tcgcgccggc ggcctgcctg acctgcggct tccatgtccg gctcgtcggt       960
     gcgctcggcc gcctgttcgg ggtgtgcgcg aacgagctcg ccccggatga cggccgggtc      1020
     acagccgtcg accacggctg cggagcccat tcggaggcgc tggtcgcgcc ctcggcgcgt      1080
     ccggagccgg tccccttcga cgaggacccc tccgacctga ctccgaccga catcgagctg      1140
     gtcggggtgg ccacgcactc cccgggctca gtcccggacc agccccccgg caccgccgac      1200
     gccgacgccg gcccggagcc ctacggccac tcctga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page