(data stored in ACNUC7421 zone)

EMBL: CP000820.PE153

CP000820.PE153       Location/Qualifiers
FT   CDS_pept        complement(184343..186652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0155"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: fal:FRAAL6730
FT                   phosphoribosylformylglycinamidine synthase II (FGAM
FT                   synthase II); TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09622"
FT                   /db_xref="GOA:A8LCI3"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LCI3"
FT                   /protein_id="ABW09622.1"
FT                   /translation="MTGTPSAPTTSPDDQADGPGEGTVDRQPYRELGLTDDEYERIVAT
FT                   LGRVPTDAELAMYSVMWSEHCSYKSSKVHLRQFRDTPATDRLLVGMGENAGVVDVGEGL
FT                   AVTFKVESHNHPSFVEPYQGAATGVGGIVRDILTMGARPIGILDPLRFGAADAPDTARV
FT                   LPGVVAGIGGYGNCLGLPTIGGEVVFDPVYGGNPLVNALCVGVMPVGRVQTSAATGVGN
FT                   AVVLLGAKTGRDGIGGVSVLASATFDEGGGPARRPSVQVGDPFTEKILIECCLELFDRG
FT                   LVTGIQDLGGAGLTCALTETTAAGIATGQPGGMEVDLDLVPLREASMAAHEVLASESQE
FT                   RMLAIVTPDALPEVLALAERWGVIATNIGTVTDSGRLVVRWHGEVVVDVPPGSLADDGP
FT                   VYERPLRRPADLDLLRADAPSALERPRTGDALRATLLRMIASPNLCSRAWVTEQYDRYV
FT                   QANTVLAQPEDAGVLRLSASGLGIALATDGNGRYARLDPFAGAQLALAEACRNVTAAGA
FT                   EPIAVTNCLNFGSPEDPEVMWQFAQACAGLADACRRLGLPVTGGNVSFYNQTGSAPIHP
FT                   TPVVGVLGLFDDVTRRTPIGFTDEGDALLLLGDTRDEFGGSEWAWATHGHLGGTPPAVD
FT                   LEREKLLGEILVGGSREGLLTAAHDLSEGGLAQALVESCLRGGHGARIELPAGADAFVE
FT                   LFSESAGRAVVAVPAAEQDRFARLCADRGLPCRQIGVVTDGEGGSLNVAGEFAIPLDEL
FT                   RAAHEGTLPRLFGRGA"
     gtgaccggaa cgccttccgc ccccacgacc agccccgacg accaggccga cggcccgggc        60
     gagggcaccg tcgaccgcca gccctaccgc gagctgggcc tgaccgacga cgagtacgaa       120
     cggatcgtcg ccaccctcgg ccgggtcccc accgacgccg agctggccat gtactcggtg       180
     atgtggagcg agcactgctc gtacaagtcg tccaaggtgc acctgcgcca gttccgggac       240
     actccggcca cagaccggct cctggtcggc atgggtgaga acgccggcgt ggtggacgtc       300
     ggcgagggcc tggccgtcac cttcaaggtc gagtcgcaca accacccgag cttcgtcgag       360
     ccgtaccagg gcgcggcgac cggtgtcggc ggcatcgtcc gcgacatcct gaccatgggg       420
     gcccggccga tcgggatcct cgacccgctg cgcttcggcg ccgccgacgc ccccgacacc       480
     gcccgggtgc tgcccggcgt ggtcgccggg atcggcggct atggcaactg cctgggcctg       540
     cccaccatcg gcggcgaggt cgtcttcgac ccggtgtacg gcgggaaccc gctggtcaac       600
     gcgctgtgcg tcggcgtgat gccggtcggg cgggtgcaga catccgccgc caccggggtc       660
     ggcaacgccg tggtgctgct cggcgcgaaa accggccggg acggcatcgg cggcgtctca       720
     gtgctcgcct cggccacctt cgacgagggc ggcggcccgg cccggcggcc gtccgtgcag       780
     gtcggggacc cgttcactga gaagatcctc atcgagtgct gcctggagct gttcgaccgc       840
     ggcctggtca ccggcatcca ggacctcggc ggcgccggcc tgacctgcgc gctcaccgag       900
     acgaccgccg ccggcatcgc caccggccag cccggcggca tggaggtcga cctcgacctc       960
     gtaccgctgc gcgaggcgtc gatggccgcg cacgaggtcc tggccagcga gtcccaggag      1020
     cggatgctgg ccatcgtcac cccggacgcg ctgcccgagg tgctggcgct cgccgagcgg      1080
     tggggcgtga tcgccaccaa catcggcacg gtgaccgaca gcggccgtct cgtcgtccgc      1140
     tggcacggcg aggtcgtcgt ggacgtcccg ccgggctcgc tcgccgacga cgggccggtc      1200
     tacgagcgcc cgctgcgccg cccggccgac ctcgacctgc tgcgggcgga cgcgccgtcc      1260
     gccctggaac ggccgcgtac cggcgacgcg ctgcgtgcga ccctgctgcg gatgatcgcc      1320
     tctccgaacc tgtgctcgcg ggcctgggtg accgagcagt acgaccggta cgtgcaggcc      1380
     aacacggtgc tggcccagcc cgaggacgcc ggcgtcctgc ggctgtcggc ctccgggctc      1440
     ggcatcgcgc tggccaccga cggcaacggc cgctacgccc ggctggaccc gttcgccggg      1500
     gcgcagctcg ccctggccga ggcgtgccgc aacgtcaccg cggccggcgc cgagccgatc      1560
     gcggtgacca actgcctgaa cttcggctcc cccgaggacc cggaggtcat gtggcagttc      1620
     gcccaggcct gcgccgggct cgccgacgcc tgccggcggc tcggcctgcc ggtcaccggc      1680
     gggaacgtgt ccttctacaa ccagaccggc tcggcgccga tccatccgac gccggtcgtc      1740
     ggcgtgctcg gcctgttcga cgacgtcact cgccgcaccc ccatcggctt cacggacgag      1800
     ggcgacgcgc tgctcctgct gggcgacacc cgggacgagt tcggcggctc cgagtgggcc      1860
     tgggcgaccc acggccatct cggcgggacg ccgccggccg tcgacctgga acgggagaag      1920
     ctgctcggcg agatcctcgt cgggggctcc cgcgaagggc tgctcaccgc ggcccacgac      1980
     ctctccgagg gcgggctcgc ccaggcgctg gtcgagtcct gcctgcgggg cgggcacggg      2040
     gcacggatcg agctgcccgc cggggcggac gcgttcgtcg agctgttcag cgaatcggcc      2100
     ggacgggcgg tcgtcgccgt ccccgccgcc gagcaggacc gtttcgcgcg gctgtgcgcg      2160
     gaccggggct tgccatgccg gcagatcggc gtcgtgaccg acggcgaagg cggaagcctg      2220
     aacgtcgccg gcgagttcgc cataccgctg gacgagctgc gggcggccca cgagggcacg      2280
     ctgccccgcc tgttcggccg cggagcctga                                       2310
//

If you have problems or comments...

PBIL Back to PBIL home page