(data stored in ACNUC7421 zone)

EMBL: CP000820.PE155

CP000820.PE155       Location/Qualifiers
FT   CDS_pept        complement(187820..188188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0157"
FT                   /product="ABC-type proline/glycine betaine transport
FT                   systems permease component-like protein"
FT                   /note="KEGG: fal:FRAAL6728 putative ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09624"
FT                   /db_xref="GOA:A8LCI5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI5"
FT                   /protein_id="ABW09624.1"
FT                   /translation="MDGVSTPTGVSGWQILRDVELPLAAPMIIIGLRLAAVQVVGTATI
FT                   ATLIGGGGLGRFVVDGLAHADVRQVAVGRGSPSCGRPGDNGRSGLHWQLVARQGDPGRG
FT                   RAARQRQRRQDEGWGRRT"
     gtggacgggg tgagcacgcc gaccggcgtg tccggctggc agatcctgcg cgacgtcgag        60
     ctcccgctgg ccgcgccgat gatcataatc gggctgcggc tggcggcggt gcaggtcgtc       120
     gggacggcga ccatcgccac gctgatcggc ggcggcggcc tcggccggtt cgtggtggac       180
     ggcctggccc acgcggacgt ccgacaggtc gccgtcggcc ggggttcccc gagttgcggt       240
     cgtcctggtg acaacggccg gtctgggttg cactggcaac tggtcgcacg gcagggtgac       300
     ccggggcggg gccgggccgc acgccaacga caacggcgac aggacgaggg atggggtcgg       360
     cgaacgtga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page