(data stored in ACNUC7421 zone)

EMBL: CP000820.PE156

CP000820.PE156       Location/Qualifiers
FT   CDS_pept        complement(188268..188987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0158"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: fal:FRAAL6724
FT                   phosphoribosylformylglycinamidine synthase I (FGAM synthase
FT                   I); TIGRFAM: phosphoribosylformylglycinamidine synthase I;
FT                   PFAM: CobB/CobQ domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09625"
FT                   /db_xref="GOA:A8LCI6"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI6"
FT                   /protein_id="ABW09625.1"
FT                   /translation="MVGAAAGGGGAARAPRVGVVTFPGSLDDRDAAAAVRLAGAEPVPL
FT                   WHGDDELSGVDAVVFPGGFSYGDYLRAGAIARFSPVVGAVVEAARAGLPVLGICNGFQV
FT                   LCEAGLLPGALTRNAGLHFVCRDQRLRVATTSTAWTSAYSPGEEIVVPVKHGEGRYVAD
FT                   AATLAQLAAQDRVVVRYVGGNPNGSVDDIAGVCSENRRVVGLMPHPEHAVEELTGPGTD
FT                   GLRMFTSVLGALLRPAA"
     atggtgggag cagctgccgg cggcggcggc gcggcacgcg ccccgcgagt cggcgtggtg        60
     accttcccgg gttcgttgga cgaccgggac gccgcggcgg ccgtgcgcct cgccggcgcc       120
     gagccggtgc cgctctggca cggcgacgac gagctgtccg gggtggacgc ggtcgtcttc       180
     cccggcggct tctcctacgg cgactatctg cgggccgggg cgatcgcccg gttctcgccg       240
     gtcgtcggcg ccgtcgtcga ggcggcccgc gcgggcctgc ccgtcctggg gatctgcaac       300
     gggttccagg tgctgtgcga ggccgggctg ctgccgggcg cgctgacccg caacgcgggg       360
     ttgcacttcg tgtgccgtga ccagcggctg cgggtcgcga ccaccagcac cgcctggacc       420
     agcgcctact cccccggcga ggagatcgtc gtcccggtca agcacggcga gggccgctac       480
     gtcgccgacg ccgcgaccct ggcccagctc gccgcgcagg acagggtggt cgtccgctac       540
     gtgggtggca acccgaacgg ctcggtggac gacatcgccg gagtgtgcag cgagaaccgg       600
     cgggtggtcg gcctgatgcc acatccggag cacgccgtcg aggagctcac cggtccgggc       660
     acagacggcc tgcggatgtt cacctcggta ctcggcgcgc tgctccgccc cgccgcctag       720
//

If you have problems or comments...

PBIL Back to PBIL home page