(data stored in ACNUC7421 zone)

EMBL: CP000820.PE163

CP000820.PE163       Location/Qualifiers
FT   CDS_pept        complement(197523..198464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0165"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   fal:FRAAL6715 hypothetical protein; putative protein
FT                   kinase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09632"
FT                   /db_xref="GOA:A8LCJ3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ3"
FT                   /protein_id="ABW09632.1"
FT                   /translation="MDPEPGVAGRFSAQRSRHALGRICSSVGLDDRDAEPIKLTVNAVY
FT                   RLPREAAVVRIASSTAMNHRVEKVVRVARWLAEHEMPAVRLFPGLSAPVTVDGHVATVW
FT                   VDAAPPTGAPAAPGGAGGAAGARDLAAILRRLHALPPPDPPLPVWDPLDDVRRRLSDAE
FT                   GLGVDDRRFLEDLALRVDEALATVRYALPRTVVHGDAHLGNLIRSATGEVVICDFDATC
FT                   QGPAEWDLVPVAVGALRFGRPPTPQLELARAYGFDVTAWEGFGVLRSVRELKLVTSVVP
FT                   ILASSPTAAAQFAVRVGSLRSGSDQTVWTPYR"
     gtggatcccg aaccaggtgt cgccggccgc ttcagcgcgc agcggtcgcg gcacgcgctc        60
     ggtcgcatct gttcgagcgt cggcctggac gaccgcgacg ccgagccgat caagctgacc       120
     gtgaacgcgg tgtaccggct gccccgcgag gcggcggtcg tgcgcatcgc cagctccacc       180
     gcgatgaacc accgggttga gaaggtcgtg cgggtcgcgc gctggctcgc cgagcacgag       240
     atgccggcgg tccggctgtt ccccggcctg tccgccccgg tcaccgtgga cgggcacgtc       300
     gccaccgtct gggtcgacgc ggcccctccc accggcgcgc ccgcggctcc cggcggggcc       360
     ggtggagccg ctggcgcccg ggatctggcg gccatcctgc gccggctgca cgccctgcca       420
     ccgcccgatc cgccgctgcc ggtgtgggac ccgctcgacg acgtccggcg gcgactctcc       480
     gacgccgagg ggctcggcgt cgacgaccgg cggttcctgg aggacctcgc gctgcgggtg       540
     gacgaggcgc tcgcgaccgt gcggtacgcg ttgccgcgca ccgtcgtcca cggggacgcg       600
     cacctgggca acctcatccg gtcggcgacg ggcgaggtcg tgatctgcga cttcgacgcg       660
     acctgccagg ggccggcgga gtgggatctt gtcccggtgg cggtgggcgc gctgcgcttc       720
     ggccgcccgc ccacgccgca gctcgagctg gcccgcgcct acggattcga cgtcaccgcc       780
     tgggaggggt tcggggtgct gcgctccgtg cgcgagctga agctggtgac gagcgtcgtc       840
     ccgatcctcg ccagcagccc gacggccgcg gcccagttcg cggtcagggt gggcagcctc       900
     cgctcgggct ccgaccagac ggtctggacc ccttatcgct ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page