(data stored in ACNUC7421 zone)

EMBL: CP000820.PE170

CP000820.PE170       Location/Qualifiers
FT   CDS_pept        205839..208469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09639"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK0"
FT                   /protein_id="ABW09639.1"
FT                   /translation="MSPSTGRVPGPPGTLAHWLRALPDDTLVRLFRLRPDLATPPPPDF
FT                   DILAARLEIRGSVSRALERLDTFTLEVVQALTLLPSPVSVAELTAFCGGLDLRAALESL
FT                   RERLVVWGPDEALRLVGVAFDLLGERPLGLGRPVRACLAGYRQAQLARVAAAVGLPDAV
FT                   SDGLSASSGGLGDSDDSDLDLDLDSEFHLGAGSHPVRRESMIEMVSAAFADPHRVAALL
FT                   DGCSARARRLAERLAAGPALGATSDAERLLSVSSARSPVEELLARGLLIGIEPGTVELP
FT                   REVGLVLRGADQAGPLHPEPPEVTGREVGAGAVDPAAALAADALVRAVTTLLTAWGSTP
FT                   VTPLRTGGLSVRDLKNSARLMDVPETEAAVVIEAAAAAGLVDLTPGTDVQFVPTNVYDR
FT                   WCTETVAMRWAVLAEGWLRSPSAAWLVGGRDERGRQIAAMSLDARRPGAPDLRADVLRV
FT                   VAAAPEGFAPTPESVRARLAWRSPRRTGPLLDGMIGGTLTEAEVVGFTGRGAPSTLGQL
FT                   VARRLAAAEADDPGRGSGRSPAADEGLCRLLADAMAPLLPEPVEELLIQTDLTAVAPGP
FT                   LVPRVAAELSRMADIESAGAATVYRFTESSLRRAMDAGSSADDLHDLLGHLARGGVPQS
FT                   LTYLIDDTARRHGRLRSGPAASYLRCDDTALLTEVVASRRTQALAMRRVAPTIVISPLP
FT                   VSDLLEGLRAAGFAPVAEAPDGRIVLARPEVHRTPARARPPAAESVPTRSNQLRDVVRL
FT                   VRRGDDSTRAARAAQDAAGAQLGLARSAPVILVMLQGAVRDRRRVLLGYVNQQGTPSDR
FT                   VVRPTLLEGGWLTAWDERSEAPRRFALHRVTGVADIDDPFGGPPVPDTGDWVVPPAADD
FT                   LPGPR"
     atgtccccgt cgacaggccg ggtcccgggc ccgcccggaa cgctcgccca ctggctgcgc        60
     gcgctgccgg acgacaccct ggtccggctg ttcagactcc ggcccgatct cgccaccccg       120
     cccccaccag acttcgacat cctcgcggcg cggctggaga tccgcggcag cgtgagtcgg       180
     gcgctggagc ggctggacac cttcaccctc gaggtcgtcc aggcgctgac gctgctgccg       240
     agcccggtct ccgtggccga gctgaccgcc ttctgcggcg ggctcgacct gcgtgccgcc       300
     ctcgagagcc tgcgggagcg actcgtcgtc tggggcccgg acgaggcgtt gcgcctggtc       360
     ggcgtcgcct tcgacctgct gggcgagcgt ccgctcgggt tggggcggcc ggtgcgggcg       420
     tgcctggccg gctaccggca ggcgcagctc gcccgggtgg cggcggccgt ggggctgccc       480
     gacgcggtgt ccgacgggtt gtccgccagc tcgggcggcc tcggcgactc ggacgactcc       540
     gatctcgatc tcgatctcga ctccgaattc caccttggtg ccggcagcca tcccgtccgg       600
     cgcgagagca tgatcgagat ggtgtcggcc gccttcgcgg accctcaccg cgtcgccgcc       660
     ctgctcgacg ggtgctcggc gcgggcgcgg cggctggccg aacggctcgc tgccggcccg       720
     gcgctgggcg ctaccagcga cgccgaacgt ctgctgagtg tgtcctccgc ccgcagcccc       780
     gtcgaggagc tgctggcccg cgggctgctc atcggcatcg agccgggcac cgtcgagctg       840
     cccagggagg tcggcctggt gctgcgcggc gccgaccagg ccgggccgct gcatcccgag       900
     ccgcctgagg tcaccggccg cgaggtgggg gcgggcgccg tcgacccggc cgccgcgctg       960
     gccgccgacg cgctggtccg cgcggtcacc acgctgctca ccgcctgggg gagcaccccg      1020
     gtcaccccgc tgcgcaccgg cgggctcagc gtgcgcgacc tcaagaacag cgcccggctg      1080
     atggacgtcc ccgagaccga ggcggccgtc gtcatcgagg cggcggccgc ggccgggctg      1140
     gtcgacctga cacccggcac cgacgtccag ttcgtgccga ccaacgtcta cgaccggtgg      1200
     tgcaccgaga cggtggccat gcggtgggcc gtcctcgccg aagggtggct gcgctcgccg      1260
     tcggcggcct ggctggtcgg cgggcgcgac gagcgcggcc ggcagatcgc cgcgatgtcc      1320
     ctcgacgccc gccgtcccgg cgccccggac ctgcgcgccg atgtgctgcg cgtcgtcgcc      1380
     gccgcgccgg agggcttcgc gcccaccccc gagtcggtgc gcgcccgcct ggcctggcgt      1440
     tccccacgcc ggacgggccc gctgctcgac gggatgatcg gcgggacgct caccgaggcc      1500
     gaggtggtcg ggttcaccgg gcgtggtgcg cccagcaccc tcgggcagct cgtcgcgcgc      1560
     cgcctcgccg ccgccgaggc cgacgacccg gggcgtggct ccggcaggtc cccggcggcc      1620
     gacgaggggc tgtgtcgcct gctcgccgac gcgatggccc cgctgctgcc cgaacccgtc      1680
     gaggaactgc tcatccagac cgacctgacg gccgtcgccc ccggcccgct cgtgccgcgg      1740
     gtcgccgccg aactgtcccg gatggctgac atcgagtccg cgggcgcggc caccgtgtac      1800
     cgcttcaccg agagctcgct gcggcgcgcg atggacgccg gcagctccgc cgacgacctc      1860
     cacgacctgc tgggccacct cgcccgtggc ggcgtcccgc agtcgctgac ctacctgatc      1920
     gacgacacgg cccgccggca cggacggttg cggtccgggc cggccgcctc ctacctgcgc      1980
     tgcgacgaca ccgcgctgct caccgaggtc gtcgcgtccc ggcgcaccca ggccctcgcg      2040
     atgcgccggg tggccccgac gatcgtcatc tcccccctac cggtgtccga cctgctggaa      2100
     ggactgcgcg cggccggttt cgccccggtg gcggaggccc cggacgggcg cattgtgctg      2160
     gcccgcccgg aggtgcaccg cacccccgcc cgcgcccgcc cgcccgccgc ggagtccgtc      2220
     ccgaccaggt cgaaccagct gcgcgacgtc gtccgtctgg tgcgccgggg cgacgacagc      2280
     acccgcgccg cgcgggcggc gcaggacgcc gcgggggcgc agctcgggct cgcacgctcc      2340
     gccccggtga tcctggtgat gctgcagggc gcggtccggg accgccggcg cgtcctgctc      2400
     ggctatgtca accagcaggg gactcccagc gaccgggtcg tgcgcccgac gctgctggag      2460
     ggcggttggc tcaccgcgtg ggacgagcgc agcgaggctc cccgccgctt cgccctgcac      2520
     cgggtgaccg gggtggccga catcgacgac ccgttcggcg gcccgccggt gcccgacacc      2580
     ggcgactggg tggttccgcc ggcggccgac gacctgcccg gcccgcgctg a               2631
//

If you have problems or comments...

PBIL Back to PBIL home page