(data stored in ACNUC7421 zone)

EMBL: CP000820.PE171

CP000820.PE171       Location/Qualifiers
FT   CDS_pept        208620..210257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0173"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: fal:FRAAL6703
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09640"
FT                   /db_xref="GOA:A8LCK1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK1"
FT                   /protein_id="ABW09640.1"
FT                   /translation="MPDGPLIVQSDKTLLLEVDHPLAPEARASIAPFAELERSPEHVHT
FT                   YRVTPLALWNARAAGHDAEQVVDALVRYSRYAVPNALLVDVADTMDRYGRLRLENDPVH
FT                   GLVMRALDRAVLTEVTRAKRVAPMLGARVDDDTVIVHPSERGRLKQALLKVGWPAEDLA
FT                   GYVDGEKHEIVLREEGWSLRDYQKGAVAGFWEGGSGVVVLPSGAGKTVVGAAAMARAGA
FT                   TTLILVTNTVAGRQWRTELLRRTTLTEDEIGEYSGERKEIRPVTIATYQVMTARRKGEY
FT                   LHLELFGARDWGLIVYDEVHLLPAPVFRMTADIQSRRRLGLTATLIREDGREGDVFSLI
FT                   GPKRYDAPWRDIEAQGWIAPAECTEVRVTLTDDERMTYAVAEPEERYKVCSTAHSKNLV
FT                   VRRLVERHADDRVLVIGAYLDQLDELGRLLDAPVIQGSTRNKERERLFEAFRTGEITTL
FT                   VVSKVANVSIDLPEAGVAIQVSGTFGSRQEEAQRLGRVLRPKADGRSAHFYTVVSRDTL
FT                   DQEYAAHRQRFLAEQGYAYTIVDADDVA"
     ttgccggatg gtcccctgat cgtccagtcg gacaagaccc tcctgctgga ggtcgatcac        60
     ccgctcgccc cggaggcacg ggcgtcgatc gcgccgttcg cggagctgga gcgctcgccc       120
     gagcacgtgc acacctaccg ggtgacgccg ctcgcgctgt ggaacgcccg cgcggccggg       180
     cacgacgccg agcaggtcgt cgacgccctc gtccgctact cgaggtacgc cgtcccgaac       240
     gcgctgctgg tcgacgtcgc cgacacgatg gaccgttacg ggcgcctccg gctggagaac       300
     gaccccgtgc acggcctggt gatgcgcgcg ctggacaggg ccgtcctgac cgaggtgacc       360
     agggccaagc gggtagcgcc catgctcggt gcccgggtcg acgacgacac ggtgatcgtg       420
     cacccgtccg agcgcggccg gctcaagcag gcgctgctca aggtcggctg gcccgccgag       480
     gatctcgccg gctacgtcga cggcgagaag cacgagatcg tgctgcgcga ggaggggtgg       540
     tccctgcggg actaccagaa gggcgcggtg gccggcttct gggagggcgg ctccggtgtc       600
     gtggtccttc ccagcggcgc gggcaagacg gtcgtcggcg ccgcggcgat ggcccgcgcc       660
     ggcgctacca cgctgatcct ggtcaccaac accgtcgccg gtcggcagtg gcgcaccgag       720
     ctgctgcggc ggaccacgct gaccgaggac gagatcggcg agtactccgg cgagcgtaag       780
     gagatccgtc ccgtcaccat cgccacatac caggtgatga cggcccgccg gaagggtgag       840
     tacctgcacc tggagctgtt cggcgcgcgt gactggggcc tgatcgtcta tgacgaggtc       900
     cacctgctgc ccgccccggt cttccggatg acggcggaca tccagtcccg ccgtcgcctg       960
     gggctgaccg ccacgctcat ccgcgaggac ggccgcgagg gggacgtgtt ctccctcatc      1020
     gggccgaagc gctacgacgc tccgtggcgc gatatcgagg cccagggctg gatcgcgccg      1080
     gcggagtgca cggaggtccg ggtcacgctc accgacgacg agcggatgac ctacgccgtc      1140
     gccgagccgg aggagcggta caaggtctgt tccaccgcgc acagcaagaa cctggtcgtg      1200
     cgccggctcg tcgagcgcca cgccgacgac cgggtgctgg tcatcggcgc ctacctggac      1260
     cagctcgacg agctggggcg cctgctcgac gcgccggtga tccagggctc cactcgcaac      1320
     aaggaacgcg agcggctctt cgaggccttc cggaccggcg agatcacgac gctggtcgtg      1380
     tcgaaggtcg ccaacgtctc catcgacctg ccggaggccg gggtggccat ccaggtcagc      1440
     ggcaccttcg gttcccgcca ggaggaggcc cagcgcctcg gccgggtgct gcggcccaag      1500
     gcggacggcc gctccgcgca cttctacacc gtggtctccc gggacaccct cgaccaggag      1560
     tacgccgcgc accgtcagcg cttcctggcc gagcagggct acgcctacac catcgtcgac      1620
     gccgacgacg tggcctga                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page