(data stored in ACNUC7421 zone)

EMBL: CP000820.PE174

CP000820.PE174       Location/Qualifiers
FT   CDS_pept        complement(213806..215083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0176"
FT                   /product="threonine synthase"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: fal:FRAAL6700 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09643"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK4"
FT                   /protein_id="ABW09643.1"
FT                   /translation="MTLAPERATLPSPDAANPAVSLSCRHCGATYPLSATHVCVECFAP
FT                   LEIAYDEDRLRKVTRASIEAGPSNLWRYVGLLPAGHVAERRVSLDAGWTPLRPAQRLAA
FT                   ELGMRTLWVKDDSANPTHSFKDRVVSVALTAARELGFHTVACASTGNLAQSVAAHAASA
FT                   GLRSVVLVPHDLEAGKTVSTAVYGGTLVAIKGNYDDVNRLCSELAGEYEWAFVNVNVRP
FT                   FYAEGSKTLGYEVAEQLGWRIPGQVVVPIASGSLLTKVDKAFGELGRLGLVEPTPYKVF
FT                   GAQAAGCNPVAAAYARGADTVAPVKPSTIAKSLSIGNPADGPYALDVARRTGGAITDVT
FT                   DDEIVDGIRLLARTEGIFGETAGGVTVACLRRLLNEGLLDPDVETVIYNTGDGLKTLDP
FT                   LVSTGGPTATIPPSLSAFEAAGLGDD"
     atgactctcg cgcccgagcg cgccactctc ccgagcccgg acgccgccaa ccccgccgtc        60
     tcgctgtcct gtcgtcactg cggtgccacc tacccgctgt cggccaccca cgtctgcgtc       120
     gagtgtttcg cgccgctcga gatcgcctac gacgaggacc ggctgcgcaa ggtcacccgg       180
     gcgtcgatcg aggccgggcc gtccaacctg tggcggtacg tcggcctgct gcccgccggg       240
     cacgtcgccg aacggcgcgt ctcgctcgac gccggctgga ccccgctgcg acccgcccag       300
     cgcctcgccg ccgagctcgg catgcgcacc ctgtgggtca aggacgacag cgcgaacccg       360
     acccactcgt tcaaggaccg ggtcgtctcg gtggccctca ccgccgcccg cgagctcggc       420
     ttccacaccg tcgcctgcgc gtccaccggg aacctcgccc agtccgtcgc cgcccacgcc       480
     gcgtccgccg gcctgcgctc ggtcgtgctc gtcccgcacg acctggaagc cggcaagacc       540
     gtgtcgacgg ccgtgtacgg cggcaccctc gtcgcgatca agggcaacta cgacgacgtc       600
     aaccggctgt gcagcgagct ggccggcgag tacgagtggg cgttcgtcaa cgtcaacgtc       660
     cggccgttct acgcggaggg ctcgaagacg ctcggctacg aggtcgccga gcagctcggc       720
     tggcgcatcc ccggccaggt cgtggtgccg atcgcctccg gctccctgct gaccaaggtc       780
     gacaaggcgt tcggtgagct cggccgcctc gggctcgtcg agcccacccc gtacaaggtc       840
     ttcggcgccc aggccgccgg ctgcaacccc gtcgccgccg cctacgcccg cggcgccgac       900
     acggtcgccc cggtgaagcc gtcgacgatc gccaagtccc tctcgatcgg caacccggcg       960
     gacggcccct acgccctcga cgtcgcccgc cgcaccggcg gcgccatcac cgacgtcacc      1020
     gacgacgaga tcgtggacgg catccgcctc ctggcccgca ccgaggggat cttcggggag      1080
     accgccggcg gcgtcaccgt cgcctgcctg cgccgcctgc tgaacgaagg cctcctcgac      1140
     ccggacgtcg agacggtgat ctacaacacc ggcgacgggc tgaagaccct cgaccccctg      1200
     gtctccacag gtggtcccac cgccacgatc ccgccctcgc tctccgcgtt cgaggccgcc      1260
     ggcctcggcg acgactag                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page