(data stored in ACNUC7421 zone)

EMBL: CP000820.PE175

CP000820.PE175       Location/Qualifiers
FT   CDS_pept        215413..216213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0177"
FT                   /product="Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /note="PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3; KEGG: fal:FRAAL6699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09644"
FT                   /db_xref="GOA:A8LCK5"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK5"
FT                   /protein_id="ABW09644.1"
FT                   /translation="MSVRVVYTDLDGTMVGPRGCFFRAEGGDTTLDPARALVDLHDAGI
FT                   ALVLVSGRTRPQLVEAAGIFGADGFIGELGAIIGWNTGLDTEILRGAMPDSFERVPESL
FT                   LDELTKLHPGRLELHTPWHTGREVDVMLRGRIDVAEVDGWLAESGFGWLSMRDNGLISP
FT                   AHMPDLGVHPHVYHLVPDGVSKGDAVAHDLKRRGVDPAEAIAIGDSASDLAMARSVGRM
FT                   HLVANAVRHPDIAALLPAYDNVVVEDGPLGAGWATAVRAALGAG"
     gtgagcgttc gcgtggtcta caccgatctc gacggaacga tggttggccc gcggggctgc        60
     ttcttccggg ccgagggcgg cgacaccacc cttgaccccg cccgcgcact cgtcgacctg       120
     cacgacgcgg gcatcgcgct ggtgctggtc tccgggagga cgaggccgca gctcgtggag       180
     gccgccggga tcttcggcgc cgacgggttc atcggcgagc tgggcgcgat catcggatgg       240
     aacaccgggc tcgacaccga gatcctgcgc ggcgcgatgc ccgactcgtt cgagcgggtg       300
     ccggagagcc tgctcgacga gctgaccaag ctgcaccccg gccgcctgga gctgcacacc       360
     ccctggcaca ccggccgcga ggtggacgtc atgctgcgtg gccggatcga tgtcgccgag       420
     gtggacggct ggctggccga gtccggtttc ggctggctga gcatgcgcga caacgggctc       480
     atctcaccgg cgcacatgcc tgatctcggg gtgcacccgc acgtctacca cctggtgccg       540
     gacggcgtca gcaagggcga cgccgtcgcg cacgacctca agcggcgcgg ggtggacccg       600
     gccgaggcga tcgccatcgg cgactccgcc agtgatctcg cgatggcccg ttcggtgggg       660
     cggatgcacc tggtggccaa cgcggtgcgc cacccggaca tcgccgcgct gctcccggcc       720
     tacgacaacg tggtggtcga ggacggcccg ctcggcgcag gttgggccac cgcagtgcgc       780
     gccgcgctcg gcgccggctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page