(data stored in ACNUC7421 zone)

EMBL: CP000820.PE178

CP000820.PE178       Location/Qualifiers
FT   CDS_pept        complement(218865..219521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6696 hypothetical protein; putative
FT                   secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09647"
FT                   /db_xref="GOA:A8LCK8"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK8"
FT                   /protein_id="ABW09647.1"
FT                   /translation="MPRGSHDFSRHPGGDRLRMAGAALVAVLAVLAGILLVNLFNGSGD
FT                   SDDGAAPAVTGEPAAPSGEPAQGVDRPEDSSSPTPSERATPSRSPSPTPGPRPSPTPQS
FT                   APAQPPAAPGTGAPKVFAPVVVLNNSRIAGLADSAANRVEAAGFRVERVGNYLGQYNVP
FT                   VSTVFYDPEDADAARTLLETVPGVERMVPRAETRIIETDTLILVVTRDFPTDDQP"
     gtgcccagag gctcccacga cttctcccgg cacccgggtg gtgaccgcct gcgcatggca        60
     ggtgccgccc tggtggccgt gctggccgta ctggccggaa ttctgctggt gaacctgttc       120
     aacgggtccg gcgactctga cgacggcgcc gccccggcgg tgaccggcga gcccgccgcc       180
     ccctcgggcg agccggcgca gggcgtagac cgccccgagg actcctccag cccgacgccg       240
     tcggagcggg cgaccccgag ccggtcgccc agcccgacac ccggcccgcg gccgtcgccg       300
     acgccgcaat ccgccccggc gcagccaccc gcggccccgg gcaccggggc gccgaaggtc       360
     ttcgcgcccg tcgtcgtgct gaacaactcc cggatcgcgg gtctcgcgga cagcgccgcc       420
     aaccgggtgg aggcggccgg cttccgggtc gaacgggtcg gcaactacct gggccagtac       480
     aacgtgccgg tttcgaccgt cttctacgat cccgaggacg ccgacgccgc gcgcaccctg       540
     ctcgagacgg ttcccggcgt cgagcgcatg gtgccccgcg cagaaacgag gatcatcgag       600
     accgacaccc tgatcctggt cgtcacccgt gacttcccga ccgacgacca gccctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page