(data stored in ACNUC7421 zone)

EMBL: CP000820.PE180

CP000820.PE180       Location/Qualifiers
FT   CDS_pept        220454..220909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09649"
FT                   /db_xref="InterPro:IPR024439"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL0"
FT                   /protein_id="ABW09649.1"
FT                   /translation="MQPPEDGPGAARGADDGRRFARTPEDFACLVCGATVRGDGYTNHC
FT                   PACLWSRHVDVNPGDRAAPCRGLMRPVGVEMRARETVLTHRCESCGHLRRNRTSPADAE
FT                   SALFALAARVADEVSLRGPGDAGLRGGAAVRGTGRGSGAPRRRGRPR"
     gtgcaaccgc ctgaggacgg gcctggtgcc gcccggggcg ccgacgacgg ccgccggttc        60
     gcccggacgc cggaggactt cgcgtgcctg gtgtgcggcg ccaccgtgcg cggcgacggg       120
     tacacgaacc actgcccggc ctgcctctgg tcgcggcatg tcgacgtcaa ccccggcgac       180
     cgcgcggcgc cgtgccgcgg gctgatgcgt cccgtcgggg tggagatgcg cgcgcgcgag       240
     accgtcctga cccaccgctg cgagagctgc gggcacctgc ggcgcaaccg gacctcgccc       300
     gccgacgccg agtccgcgct gttcgcgctg gccgcccggg tcgcggacga ggtgagcctg       360
     cggggcccgg gcgacgccgg cctcaggggt ggggcggccg tcaggggtac aggccgcggg       420
     tccggtgcgc ctcggcgacg cgggcgaccc cgatga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page