(data stored in ACNUC7421 zone)

EMBL: CP000820.PE183

CP000820.PE183       Location/Qualifiers
FT   CDS_pept        complement(223795..225693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6691 hypothetical protein; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09652"
FT                   /db_xref="GOA:A8LCL3"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL3"
FT                   /protein_id="ABW09652.1"
FT                   /translation="MTTQGDPRAARRGAAVRADGPAELVGPSHPERHGRVDRGGGDRPA
FT                   WRLILAGAIAAALAMISEARLGPRDPEVADPSSWWGILPSGQPADTARGVLAATAGLAV
FT                   IGLCLSWLLLLARARRGTISPRAAGAAALAWAVPFAVGPPLFSRDVYAYAAQGELARHG
FT                   LDPATHGINSLLSREASGDLFIAAVDPRWRDTHAPYGGLGVGVERACAALGDLLGTGAA
FT                   GTVAALRVVALISTVLLVALALRLPGGPHRADQSGRSGRCRSGRTVAIVLALLAANPFV
FT                   IIHLVGGAHLDALAAALLVAALVIDRGRVAGHGRGTGRAPSWALGATAVAFACLAGSVK
FT                   ATAFLGTGWLVFVHVRDAWHSGPTAATGRPGRRAAAIGTALAADTVAAALALLVGMAAG
FT                   GFGPTWIGALATSGKLETGIAPASVFATLVDLAPRIVGLEWPGGSDAVLGATRALVLAA
FT                   VGLTVVWLALRTWPARATARLAARPAAQATRPITPDAVRPTGPEPGRRDDLVVVGFGGM
FT                   ALVLGSPVVYPWYLALSVPFLAALVALAPSPPGRQTRAAVGLIAVTSVWLCLATLSPLA
FT                   ATWRLLGRADPLLGAALVVVLAAVVSAATVPAVRRRTTVRRRTIPAPRPEARTRPR"
     gtgaccaccc agggcgaccc acgggccgcc cgtcggggcg cggccgttcg ggcggacggc        60
     cccgccgagc tcgtgggacc atcccatccc gagcggcacg gccgcgtcga ccgagggggc       120
     ggcgaccggc ccgcgtggcg gctgatcctg gccggcgcga tcgccgccgc gctcgccatg       180
     atcagtgagg ctcggctcgg gccgcgagat cctgaagtgg ccgacccgtc gtcctggtgg       240
     ggaattctcc catccggaca gcccgcggac acggccaggg gcgtgcttgc cgccacagcc       300
     gggttggccg tgatcgggct ctgcctgagc tggctgctcc tgctggcacg cgcgcgccgc       360
     gggacgatct cgccgcgggc ggccggcgcc gccgcgctcg cgtgggccgt cccgttcgcg       420
     gtgggaccgc cgctgttcag ccgggacgtc tacgcctacg ccgcccaggg cgagctcgcc       480
     cggcacggtc tcgacccggc gacgcacggc atcaacagcc tgctctcgcg ggaggcgagc       540
     ggggatctgt tcatcgccgc ggtcgatccg cggtggcgcg acacacacgc cccctacggg       600
     gggttggggg tgggtgtcga acgcgcgtgc gcggcgctcg gtgacctgct cgggaccggc       660
     gcggccggga cggtcgccgc gctgcgggtg gtcgccctga tctcgaccgt gctcctggtc       720
     gccctggccc tgaggctgcc cggcggcccg caccgagcgg accagagtgg ccgttctggt       780
     cggtgccgtt ctggtcggac ggtggcgatc gtgctcgcgc tgctggcggc gaacccgttt       840
     gtgatcattc atctggtcgg cggcgcgcac ctggacgccc tcgccgccgc gctgctcgtc       900
     gcggcgctgg tgatcgaccg tggccgggtg gccggtcacg gccgggggac cggtcgcgct       960
     cccagctggg ctctcggcgc caccgcggtg gccttcgcgt gtcttgccgg cagcgtgaag      1020
     gccaccgcgt tcctcggcac cggctggctg gtcttcgtcc acgtccgcga tgcctggcac      1080
     tccggaccga ccgcggccac cgggcggccc ggccggcgcg cggcggcgat cgggacggcg      1140
     ctcgccgcgg acaccgtggc ggcggccctg gctctgctgg tcgggatggc cgcaggcgga      1200
     ttcgggccga cctggatagg cgcgttggcc acctcgggca agctcgagac cggcatcgcg      1260
     cccgcctcgg tcttcgcgac cctcgtcgac ctggcgccgc ggatcgtcgg cctcgagtgg      1320
     cccggaggct ccgacgccgt gctcggcgcc acccgcgccc tcgtgctggc cgctgtcggc      1380
     ctgaccgtcg tctggctcgc gctgcggacc tggccggcac gagcgacggc gcgactggcg      1440
     gcacgaccgg cggcgcaggc cacccggccg atcacgcccg acgccgtcag gccgaccggg      1500
     ccggagcccg gccgccggga cgacctggtt gtcgtgggct tcggggggat ggccctggtg      1560
     ctcggctccc ccgtggtcta cccgtggtat ctcgctctga gcgtgccgtt cctggccgcg      1620
     ctggtcgcac tcgccccatc cccgcccgga cggcagaccc gcgcggccgt cgggctgatc      1680
     gccgtcacgt cggtttggct gtgcctcgcg acgctgtcgc cgctcgccgc cacctggcga      1740
     ctgctcggcc gggccgaccc gctgctcggc gctgccctgg tggtggtgtt ggcggcagtg      1800
     gtgtcggcgg cgactgtgcc ggcggtccgt cgccggacga ctgtccgtcg ccggacgatt      1860
     cccgcgccgc ggcccgaagc gcgtaccagg ccgcggtga                             1899
//

If you have problems or comments...

PBIL Back to PBIL home page