(data stored in ACNUC7421 zone)

EMBL: CP000820.PE187

CP000820.PE187       Location/Qualifiers
FT   CDS_pept        complement(231593..233140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0189"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: fal:FRAAL6682
FT                   conserved hypothetical protein; putative metallo-dependent
FT                   phosphatase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09656"
FT                   /db_xref="GOA:A8LCL7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL7"
FT                   /protein_id="ABW09656.1"
FT                   /translation="MPHSLRGPRRSRSRSSESPASAPRDAAPRDAPPRPGGGPSHAEHG
FT                   VHLAFGADPATSMVVSWITREPVVRPLARVVTGTAEAVREVEAGTRSYTDAATGWEIYA
FT                   HHALLDELAPDTEYTYEITYQTTAAGVVREVGRASFRTAPRGRAAFTFACFGDHGTDAS
FT                   DNPFGTPASGALVAGVERVDPLFTLVDGDLAYSNVSDVPPRAWADWFAMISTSAARRPW
FT                   MPSVGNHETERGNGALGLAAYQTYFQPPDNGEEPYLAGLWYAFTVGGVRFVVLSGDDVC
FT                   YQDAGRVYLHGYSSGRQTAWLERQLAEARADQAVDWIIVALHQAAVSTAEFHNGADLGL
FT                   REAWLPLFDQYGVDLVISGHEHHYERTHPLRGVVDGSTTLTPRPVPGSVSVAGGGGGGT
FT                   ATLDTSAGTVHMLIGTGGSSTPSAGQLFDPPACRVVVGVREREPGQRQRSSIRAVEPAP
FT                   WLAARFPEHPYAFAALTVDPGEPGGTTRIQVTVYDSADAVPVPFDTFTLARPRADAT"
     atgcctcaca gccttcgcgg tccacgacgt tcccggtcac gatcctccga gtcgccggcc        60
     tccgcaccac gcgacgccgc accacgcgac gccccgccgc ggcccggcgg agggccgtcg       120
     cacgccgagc acggggtgca cctcgccttc ggcgcggatc cggcgacgtc gatggtggtc       180
     tcctggatca cccgggagcc cgtcgtccgg ccgctggccc gggtggtcac gggcaccgcc       240
     gaggcagtcc gcgaggtcga ggccggcacc aggtcgtaca cggacgcggc caccgggtgg       300
     gagatctacg cgcaccacgc gctgctggac gagctggcgc cggacaccga gtacacctac       360
     gagatcacgt accagaccac ggcggccggg gtcgtccgcg aggtgggccg ggcgtcgttc       420
     cggacggccc cccgcggccg ggccgccttc accttcgcct gcttcggcga tcacggcacc       480
     gacgcgtccg acaacccgtt cggcacgccg gcctccggcg cgctcgtcgc cggcgtcgag       540
     cgggtggacc cgctgttcac cctggtcgac ggcgatctgg cctattcgaa cgtcagcgac       600
     gtcccgccgc gggcctgggc ggactggttc gcgatgatca gcacctcggc cgcgcgccgc       660
     ccgtggatgc cgagtgtcgg caatcacgag accgagcggg gaaacggagc gctgggcctc       720
     gccgcctacc agacctactt ccagccgccg gacaacggtg aggagcctta cctggccggc       780
     ctctggtacg ccttcacagt gggtggcgta cggttcgtcg tgctcagcgg cgacgacgtc       840
     tgctaccagg acgccggccg cgtctacctg cacggctaca gctcgggtcg gcagaccgcc       900
     tggctcgagc ggcagttggc cgaggcccgg gcggaccagg cggtcgactg gatcatcgtg       960
     gccctgcacc aggcagcagt ctccacagcg gagttccaca acggcgcgga cctcggcctg      1020
     cgcgaggcct ggctgccgtt gttcgaccag tacggcgtcg acctggtgat ctccgggcac      1080
     gaacaccact acgagcgcac acacccgcta cggggggttg tggacggcag cacgacgctg      1140
     accccgcggc cggtcccggg ctcggtgtcc gtcgcggggg gcggcggggg cggtactgcc      1200
     acgctcgaca cgtccgccgg gacggtgcac atgctgatcg gcaccggcgg ctcgtccacg      1260
     ccgtcggccg ggcagctgtt cgacccgccg gcctgccggg tggtcgtcgg ggtgcgggag      1320
     cgggagcccg ggcagcggca gcgctcctcg atccgtgcgg tcgagccggc tccgtggctg      1380
     gcggcccgct tccccgagca tccgtacgcg ttcgccgcgc tcacggtcga tccgggcgag      1440
     ccgggcggga cgacccgcat ccaggtcacc gtctacgact cggcggacgc cgtgcccgtg      1500
     cccttcgaca ccttcaccct cgcccgcccg cgcgccgacg cgacctga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page